| IED ID | IndEnz0011000093 |
| Enzyme Type ID | glucanase000093 |
| Protein Name |
Probable glucan 1,3-beta-glucosidase A EC 3.2.1.58 Exo-1,3-beta-glucanase 1 Exo-1,3-beta-glucanase A |
| Gene Name | exgA exg1 AN4052 |
| Organism | Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta Eurotiomycetes Eurotiomycetidae Eurotiales (green and blue molds) Aspergillaceae Aspergillus Aspergillus subgen. Nidulantes Emericella nidulans (Aspergillus nidulans) Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) |
| Enzyme Sequence | MFPRISQAAILAHSLLAVCTSAATLAEKVRGVNLGGWLVLEPWITPSLFDEAGDEAVDEYTLTEVLGVEEAAARLSEHWNTFITEEDFALIAEAGLNYVRIPIGYWAAAPLDGEPYVSGQLEHLDNAVAWARAHNLKVIVDLHGAPGSQNGFDNSGRRGPIGWQQGDTVEQTILAFETLAQRYLADDDTVTMIEALNEPHVPGGINQDQLKDYYEETLARVRKNSPEATLLLHDGFVQTEGWNGFMTGENVMMDTHHYEVFEGGQNAWSIEKHIDAACQLGRQHLQAADKPVIVGEWTGALSDCTRYLNGKGIGIRYDGTLGSNTAVGACGSKSEGSVAGLSADEIANTRRFIEAQLDAFELRNGWVFWTWKTEGAPGWDMQDLLANGVFPQPLTDREFPNQCNF |
| Enzyme Length | 405 |
| Uniprot Accession Number | Q5B5X8 |
| Absorption | |
| Active Site | ACT_SITE 198; /note=Proton donor; /evidence=ECO:0000250; ACT_SITE 296; /note=Nucleophile; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Successive hydrolysis of beta-D-glucose units from the non-reducing ends of (1->3)-beta-D-glucans, releasing alpha-glucose.; EC=3.2.1.58; |
| DNA Binding | |
| EC Number | 3.2.1.58 |
| Enzyme Function | FUNCTION: Beta-glucanases participate in the metabolism of beta-glucan, the main structural component of the cell wall. It could also function biosynthetically as a transglycosylase (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Disulfide bond (2); Erroneous gene model prediction (2); Signal peptide (1) |
| Keywords | Carbohydrate metabolism;Cell wall biogenesis/degradation;Disulfide bond;Glycosidase;Hydrolase;Manganese;Metal-binding;Polysaccharide degradation;Reference proteome;Secreted;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..26; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 44,437 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |