| IED ID | IndEnz0011000098 |
| Enzyme Type ID | glucanase000098 |
| Protein Name |
Endoglucanase E1 EC 3.2.1.4 Cellulase E1 Endo-1,4-beta-glucanase E1 Endocellulase E1 |
| Gene Name | Acel_0614 |
| Organism | Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Actinobacteria Actinomycetia (high G+C Gram-positive bacteria) Acidothermales Acidothermaceae Acidothermus Acidothermus cellulolyticus Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) |
| Enzyme Sequence | MPRALRRVPGSRVMLRVGVVVAVLALVAALANLAVPRPARAAGGGYWHTSGREILDANNVPVRIAGINWFGFETCNYVVHGLWSRDYRSMLDQIKSLGYNTIRLPYSDDILKPGTMPNSINFYQMNQDLQGLTSLQVMDKIVAYAGQIGLRIILDRHRPDCSGQSALWYTSSVSEATWISDLQALAQRYKGNPTVVGFDLHNEPHDPACWGCGDPSIDWRLAAERAGNAVLSVNPNLLIFVEGVQSYNGDSYWWGGNLQGAGQYPVVLNVPNRLVYSAHDYATSVYPQTWFSDPTFPNNMPGIWNKNWGYLFNQNIAPVWLGEFGTTLQSTTDQTWLKTLVQYLRPTAQYGADSFQWTFWSWNPDSGDTGGILKDDWQTVDTVKDGYLAPIKSSIFDPVGASASPSSQPSPSVSPSPSPSPSASRTPTPTPTPTASPTPTLTPTATPTPTASPTPSPTAASGARCTASYQVNSDWGNGFTVTVAVTNSGSVATKTWTVSWTFGGNQTITNSWNAAVTQNGQSVTARNMSYNNVIQPGQNTTFGFQASYTGSNAAPTVACAAS |
| Enzyme Length | 562 |
| Uniprot Accession Number | P54583 |
| Absorption | |
| Active Site | ACT_SITE 203; /note=Proton donor; ACT_SITE 323; /note=Nucleophile |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Endohydrolysis of (1->4)-beta-D-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.; EC=3.2.1.4; |
| DNA Binding | |
| EC Number | 3.2.1.4 |
| Enzyme Function | FUNCTION: Has a very high specific activity on carboxymethylcellulose. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Optimum temperature is 81 degrees Celsius. Thermostable.; |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Beta strand (17); Chain (1); Compositional bias (1); Disulfide bond (2); Domain (1); Helix (12); Region (2); Signal peptide (1); Turn (9) |
| Keywords | 3D-structure;Carbohydrate metabolism;Cellulose degradation;Disulfide bond;Glycosidase;Hydrolase;Polysaccharide degradation;Reference proteome;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..41 |
| Structure 3D | X-ray crystallography (2) |
| Cross Reference PDB | 1ECE; 1VRX; |
| Mapped Pubmed ID | 15917594; |
| Motif | |
| Gene Encoded By | |
| Mass | 60,748 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |