IED ID | IndEnz0011000131 |
Enzyme Type ID | glucanase000131 |
Protein Name |
Beta-glucanase EC 3.2.1.73 1,3-1,4-beta-D-glucan 4-glucanohydrolase Endo-beta-1,3-1,4 glucanase Lichenase |
Gene Name | bglA |
Organism | Rhodothermus marinus (Rhodothermus obamensis) |
Taxonomic Lineage | cellular organisms Bacteria FCB group Bacteroidetes/Chlorobi group Bacteroidetes Bacteroidetes Order II. Incertae sedis Rhodothermaceae Rhodothermus Rhodothermus marinus (Rhodothermus obamensis) |
Enzyme Sequence | MCTMPLMKLKKMMRRTAFLLSVLIGCSMLGSDRSDKAPHWELVWSDEFDYSGLPDPEKWDYDVGGHGWGNQELQYYTRARIENARVGGGVLIIEARHEPYEGREYTSARLVTRGKASWTYGRFEIRARLPSGRGTWPAIWMLPDRQTYGSAYWPDNGEIDIMEHVGFNPDVVHGTVHTKAYNHLLGTQRGGSIRVPTARTDFHVYAIEWTPEEIRWFVDDSLYYRFPNERLTDPEADWRHWPFDQPFHLIMNIAVGGAWGGQQGVDPEAFPAQLVVDYVRVYRWVE |
Enzyme Length | 286 |
Uniprot Accession Number | P45798 |
Absorption | |
Active Site | ACT_SITE 158; /note=Nucleophile; /evidence=ECO:0000255|PROSITE-ProRule:PRU10064; ACT_SITE 163; /note=Proton donor; /evidence=ECO:0000255|PROSITE-ProRule:PRU10064 |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | CATALYTIC ACTIVITY: Reaction=Hydrolysis of (1->4)-beta-D-glucosidic linkages in beta-D-glucans containing (1->3)- and (1->4)-bonds.; EC=3.2.1.73; |
DNA Binding | |
EC Number | 3.2.1.73 |
Enzyme Function | FUNCTION: Shows activity on lichenan, beta-glucan and laminarin but not on CMC cellulose or xylan. |
Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Optimum temperature is 85 degrees Celsius.; |
PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 7.0.; |
Pathway | |
nucleotide Binding | |
Features | Active site (2); Chain (1); Domain (1); Signal peptide (1) |
Keywords | Glycosidase;Hydrolase;Signal |
Interact With | |
Induction | |
Subcellular Location | |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | SIGNAL 1..30; /evidence=ECO:0000255 |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 33,145 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda | 3.2.1.73; |