| IED ID |
IndEnz0011000132 |
| Enzyme Type ID |
glucanase000132 |
| Protein Name |
Glucanase inhibitor protein 1
|
| Gene Name |
GIP1 |
| Organism |
Phytophthora sojae (Soybean stem and root rot agent) (Phytophthora megasperma f. sp. glycines) |
| Taxonomic Lineage |
cellular organisms
Eukaryota
Sar
Stramenopiles
Oomycota
Peronosporales
Peronosporaceae
Phytophthora
Phytophthora sojae (Soybean stem and root rot agent) (Phytophthora megasperma f. sp. glycines)
|
| Enzyme Sequence |
MKVFPALTSALVALGTAGVEAEHVQRSLVMGGGTVPVGAKTYTVGLRTTAEGDTFCGGALISPTHVLTTATCTASLGSGPAEWAAVGTHYLNGAKDGERLKVVSAQNHTLYNPNNFAYNFAVLTLEKPSKFSPVKLPAADGSDIAPSMSSKLMGWGDTSYPNGARANELQSVELRVVTSNCTYTVGPSEVCAGGEEGKDKCAGDTGGPLIKENGSGDADDILIGLASWGMPCGHKDVASVYARVSAGLEWINSVIKK |
| Enzyme Length |
257 |
| Uniprot Accession Number |
Q945U0 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Secreted effector that suppresses host plant glucan elicitor-mediated defense responses (PubMed:12084830, PubMed:15545660). Targets host endoglucanase EGaseA and inhibits the EGaseA-mediated release of elicitor-active glucan oligosaccharides from P.sojae cell walls (PubMed:12084830, PubMed:15545660). {ECO:0000269|PubMed:12084830, ECO:0000269|PubMed:15545660}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Disulfide bond (3); Domain (1); Glycosylation (3); Signal peptide (1) |
| Keywords |
Direct protein sequencing;Disulfide bond;Glycoprotein;Secreted;Signal;Virulence |
| Interact With |
|
| Induction |
INDUCTION: Expressed during pathogen infection. {ECO:0000269|PubMed:12084830}. |
| Subcellular Location |
SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:12084830}. |
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
SIGNAL 1..28; /evidence=ECO:0000269|PubMed:12084830 |
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
26,467 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|