| IED ID | IndEnz0011000167 |
| Enzyme Type ID | glucanase000167 |
| Protein Name |
Probable endo-beta-1,4-glucanase D Endoglucanase D EC 3.2.1.4 Carboxymethylcellulase D Cellulase D |
| Gene Name | eglD AFUA_8G06830 |
| Organism | Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta Eurotiomycetes Eurotiomycetidae Eurotiales (green and blue molds) Aspergillaceae Aspergillus Aspergillus subgen. Fumigati Neosartorya fumigata (Aspergillus fumigatus) Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus) |
| Enzyme Sequence | MKSTFGLLALAAAAKLVSAHATVHAVWINDVDQGAGNSADGYIRSPPNNSPITDVTSTDMTCNVNGKNPVAKTLSVKAGDKVTFEWHHDTRSDSDDIIASSHMGPVMVYMAPTEKGTAGNGWVKIAEEGYSNGKWAVANLIANRGKHSITVPDVPAGEYLLRPEIIALHEGNRQGGAQFYMECVQVKVTSAGTKTLPAGVSIPGAYKATDPGVLFDMYNSFTSYPIPGPAVWDGSSSGSSGSSGSSPATTTAPAVSVTAAPTKEAPVDTSATPTTFVTATKPATTAAPAAPSASSGSNSGSDSCNSGSASGSVKIYGQCGGQNYSGPTSCEAGLICKEWNPYYHQCVSA |
| Enzyme Length | 349 |
| Uniprot Accession Number | Q4WBU0 |
| Absorption | |
| Active Site | ACT_SITE 164; /note=Proton donor; /evidence=ECO:0000250; ACT_SITE 210; /note=Nucleophile; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Endohydrolysis of (1->4)-beta-D-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.; EC=3.2.1.4; |
| DNA Binding | |
| EC Number | 3.2.1.4 |
| Enzyme Function | FUNCTION: Has endoglucanase activity on substrates containing beta-1,4 glycosidic bonds, like in carboxymethylcellulose (CMC), hydroxyethylcellulose (HEC) and beta-glucan. Involved in the degradation of complex natural cellulosic substrates (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Disulfide bond (2); Domain (1); Glycosylation (1); Region (3); Signal peptide (1) |
| Keywords | Carbohydrate metabolism;Cellulose degradation;Disulfide bond;Glycoprotein;Glycosidase;Hydrolase;Polysaccharide degradation;Reference proteome;Secreted;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..19; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 35,735 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |