| IED ID | IndEnz0011000197 |
| Enzyme Type ID | glucanase000197 |
| Protein Name |
Probable glucan 1,3-beta-glucosidase A EC 3.2.1.58 Exo-1,3-beta-glucanase 1 Exo-1,3-beta-glucanase A |
| Gene Name | exgA exg1 ATEG_03849 |
| Organism | Aspergillus terreus (strain NIH 2624 / FGSC A1156) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta Eurotiomycetes Eurotiomycetidae Eurotiales (green and blue molds) Aspergillaceae Aspergillus Aspergillus subgen. Circumdati Aspergillus terreus Aspergillus terreus (strain NIH 2624 / FGSC A1156) |
| Enzyme Sequence | MLYNLSKAVLALSVLAASADAAGIRLEKRASTFDYETEMVRGVCLGGWLVLEPWLSPGLFDAAPDGAVDEWTYTEILGQDEAKARLIGHWDTFITEQDFFDIAAAGMNHVRIPIGYWAVEALPGDPYVDGQLEYLDRAIEWAGAAGLKVIVDLHGAPGSQNGFDNSGRKGAIQWGQGDTLGQTVNAFRKLAERYVPSSDVVTAIEAVNEPFIPGGVNEDQLKEYYQQAYDIVTQMSPDVDLVFSDGFINPTPWNGFISDSGNIVMDNHHYEVFDINLLRMSVDDHVRSVCDFGRTQLAPATKPVVVGEWTGAMTDCARYLNGRGVGARYDGAMGGESVGDCGPFIQGSVSDLSPDDQKNMRRFIEAQLDAWEMKSGWLFWNWKTEQGAPGWDMKDLLDNGVFPFPLESRKYPGQCG |
| Enzyme Length | 416 |
| Uniprot Accession Number | Q0CR35 |
| Absorption | |
| Active Site | ACT_SITE 209; /note=Proton donor; /evidence=ECO:0000250; ACT_SITE 308; /note=Nucleophile; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Successive hydrolysis of beta-D-glucose units from the non-reducing ends of (1->3)-beta-D-glucans, releasing alpha-glucose.; EC=3.2.1.58; |
| DNA Binding | |
| EC Number | 3.2.1.58 |
| Enzyme Function | FUNCTION: Beta-glucanases participate in the metabolism of beta-glucan, the main structural component of the cell wall. It could also function biosynthetically as a transglycosylase (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Disulfide bond (2); Signal peptide (1) |
| Keywords | Carbohydrate metabolism;Cell wall biogenesis/degradation;Disulfide bond;Glycosidase;Hydrolase;Manganese;Metal-binding;Polysaccharide degradation;Reference proteome;Secreted;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..21; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 45,747 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |