| IED ID |
IndEnz0011000217 |
| Enzyme Type ID |
glucanase000217 |
| Protein Name |
Glucanase inhibitor protein 3
|
| Gene Name |
GIP3 |
| Organism |
Phytophthora infestans (Potato late blight agent) (Botrytis infestans) |
| Taxonomic Lineage |
cellular organisms
Eukaryota
Sar
Stramenopiles
Oomycota
Peronosporales
Peronosporaceae
Phytophthora
Phytophthora infestans (Potato late blight agent) (Botrytis infestans)
|
| Enzyme Sequence |
MKIISAVAASSIALGAVSATTDHVSRMLVLGGAVVPSGTKTYTTGIRPTIDGDNFCGGSLISPTHVLTTTACLRGIKPPNWVSVGTHYLNGTHDGEQIKVVAAQNHTNFNSTSGSFDVALLTLEKPSRFKPVKLPAADDSDIVAGMWSKLVGWGYTGYPEKTKAYELQGVSLQVWDNEQCGQLYPVDDTMVCAGGVKGKDSCDGDTGGPLIKERGPGDEDDIVVGLVSWGSECGVGYPGVYSRVSKALEWINSITKGK |
| Enzyme Length |
258 |
| Uniprot Accession Number |
B1AC88 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Secreted effector that suppresses host plant glucan elicitor-mediated defense responses (PubMed:18624645). Targets host endoglucanases and inhibits the endoglucanase-mediated release of elicitor-active glucan oligosaccharides from P.infestans cell walls (PubMed:18624645). {ECO:0000269|PubMed:18624645}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Disulfide bond (3); Domain (1); Glycosylation (3); Signal peptide (1) |
| Keywords |
Disulfide bond;Glycoprotein;Secreted;Signal;Virulence |
| Interact With |
|
| Induction |
INDUCTION: Expressed during infection and the expression levels increase with disease progression. {ECO:0000269|PubMed:18624645}. |
| Subcellular Location |
SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:18624645}. |
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
SIGNAL 1..19; /evidence=ECO:0000255 |
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
27,125 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|