| IED ID | IndEnz0011000218 |
| Enzyme Type ID | glucanase000218 |
| Protein Name |
Glucanase inhibitor protein 3 Fragment |
| Gene Name | |
| Organism | Phytophthora sojae (Soybean stem and root rot agent) (Phytophthora megasperma f. sp. glycines) |
| Taxonomic Lineage | cellular organisms Eukaryota Sar Stramenopiles Oomycota Peronosporales Peronosporaceae Phytophthora Phytophthora sojae (Soybean stem and root rot agent) (Phytophthora megasperma f. sp. glycines) |
| Enzyme Sequence | VLTLEKPSKFAPIKLPKADGSDIFPRVWSKVMGWGVTSYPNGKPSNELQSVDVRVWGDNACENKLGVDKSSLCAGGEAGKDSCVGDTGDPLIKENGRGDADDILLGLSGWGTGCGDKDMPSVYSRVSAGIEWINSVIKK |
| Enzyme Length | 139 |
| Uniprot Accession Number | Q945T8 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Secreted effector that suppresses host plant glucan elicitor-mediated defense responses (Probable). Targets host endoglucanases and inhibits the endoglucanase-mediated release of elicitor-active glucan oligosaccharides from P.sojae cell walls (Probable). {ECO:0000305|PubMed:12084830}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (2); Domain (1); Non-terminal residue (1) |
| Keywords | Disulfide bond;Secreted;Virulence |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305|PubMed:12084830}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 14,715 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |