IED ID | IndEnz0011000244 |
Enzyme Type ID | glucanase000244 |
Protein Name |
Glucan endo-1,3-beta-glucosidase, acidic isoform PR-Q' EC 3.2.1.39 1- 3 -beta-glucan endohydrolase 1- 3 -beta-glucanase Beta-1,3-endoglucanase PR-35 |
Gene Name | |
Organism | Nicotiana tabacum (Common tobacco) |
Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Solanaceae Nicotianoideae Nicotianeae Nicotiana Nicotiana tabacum (Common tobacco) |
Enzyme Sequence | MAHLIVTLLLLSVLTLATLDFTGAQAGVCYGRQGNGLPSPADVVSLCNRNNIRRMRIYDPDQPTLEALRGSNIELMLGVPNPDLENVAASQANADTWVQNNVRNYGNVKFRYIAVGNEVSPLNENSKYVPVLLNAMRNIQTAISGAGLGNQIKVSTAIETGLTTDTSPPSNGRFKDDVRQFIEPIINFLVTNRAPLLVNLYPYFAIANNADIKLEYALFTSSEVVVNDNGRGYRNLFDAILDATYSALEKASGSSLEIVVSESGWPSAGAGQLTSIDNARTYNNNLISHVKGGSPKRPSGPIETYVFALFDEDQKDPEIEKHFGLFSANMQPKYQISFN |
Enzyme Length | 339 |
Uniprot Accession Number | P36401 |
Absorption | |
Active Site | ACT_SITE 118; /note=Proton donor; /evidence=ECO:0000250|UniProtKB:O22317; ACT_SITE 262; /note=Nucleophile; /evidence=ECO:0000250|UniProtKB:O22317 |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | CATALYTIC ACTIVITY: Reaction=Hydrolysis of (1->3)-beta-D-glucosidic linkages in (1->3)-beta-D-glucans.; EC=3.2.1.39; |
DNA Binding | |
EC Number | 3.2.1.39 |
Enzyme Function | FUNCTION: Implicated in the defense of plants against pathogens. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Active site (2); Chain (1); Erroneous initiation (1); Modified residue (1); Sequence conflict (1); Signal peptide (1) |
Keywords | Apoplast;Direct protein sequencing;Glycosidase;Hydrolase;Plant defense;Pyrrolidone carboxylic acid;Reference proteome;Secreted;Signal |
Interact With | |
Induction | INDUCTION: Accumulates following infection. |
Subcellular Location | SUBCELLULAR LOCATION: Secreted, extracellular space, apoplast. |
Modified Residue | MOD_RES 25; /note=Pyrrolidone carboxylic acid; /evidence=ECO:0000250|UniProtKB:P15797 |
Post Translational Modification | PTM: The N-terminus is blocked. |
Signal Peptide | SIGNAL 1..24; /evidence=ECO:0000255 |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 36,995 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |