| IED ID | IndEnz0011000249 |
| Enzyme Type ID | glucanase000249 |
| Protein Name |
Glucan 1,3-beta-glucosidase ARB_02797 EC 3.2.1.58 Exo-1,3-beta-glucanase |
| Gene Name | ARB_02797 |
| Organism | Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) (Trichophyton mentagrophytes) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta Eurotiomycetes Eurotiomycetidae Onygenales Arthrodermataceae (dermatophytes) Trichophyton Arthroderma benhamiae (Trichophyton mentagrophytes) Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) (Trichophyton mentagrophytes) |
| Enzyme Sequence | MRFSTALSLALAVSPAAVFAAGNLGFSLGVKRPDGQCKDQADFEKDFDTLKAHGTTVRTYAAADCGSASLILPAAKSKGFKVVLGIWPDVEESYKADVDALKKAVPGNEDVVAAITVGSETLYRGNFTGPELLKKIKEVQKVFPKITIGTADSWNKYADGTADALIEGGVKYLLVNAFAFWQGKAIEQAPKTLFDDLVGAAKRIADKAPQGSSPYVAIGETGWPTDGGTDYGAAKAGTKNAEKFYKEGVCAMLAWGVDAFYFEAFDEPWKPKSIGDNGNAADETHWGMYTADRKPKFNADCKVNKKKD |
| Enzyme Length | 308 |
| Uniprot Accession Number | D4B2W4 |
| Absorption | |
| Active Site | ACT_SITE 120; /note=Proton donor; /evidence=ECO:0000250|UniProtKB:O22317; ACT_SITE 220; /note=Nucleophile; /evidence=ECO:0000250|UniProtKB:O22317 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Successive hydrolysis of beta-D-glucose units from the non-reducing ends of (1->3)-beta-D-glucans, releasing alpha-glucose.; EC=3.2.1.58; Evidence={ECO:0000250|UniProtKB:Q5AMT2}; |
| DNA Binding | |
| EC Number | 3.2.1.58 |
| Enzyme Function | FUNCTION: Cell wall glucan 1,3-beta-glucosidase involved in cell wall biosynthesis and virulence (By similarity). Crucial for delivery of beta-1,3-glucan to the biofilm matrix and for accumulation of mature matrix biomass (By similarity). {ECO:0000250|UniProtKB:Q5AMT2}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Glycosylation (1); Signal peptide (1) |
| Keywords | Allergen;Cell wall;Cytoplasm;Glycoprotein;Glycosidase;Hydrolase;Reference proteome;Secreted;Signal |
| Interact With | |
| Induction | INDUCTION: Expression is down-regulated in presence of human keratinocytes. {ECO:0000269|PubMed:21247460}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:21247460, ECO:0000269|PubMed:21919205}. Secreted, cell wall {ECO:0000250|UniProtKB:Q5AMT2}. Cytoplasm {ECO:0000250|UniProtKB:Q5AMT2}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..20; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 32,977 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |