| IED ID | IndEnz0011000250 |
| Enzyme Type ID | glucanase000250 |
| Protein Name |
Glucan 1,3-beta-glucosidase BGL2 EC 3.2.1.58 Exo-1,3-beta-glucanase |
| Gene Name | BGL2 BGL21 CAALFM_C402250CA CaO19.12034 CaO19.4565 |
| Organism | Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Saccharomycotina (true yeasts) Saccharomycetes Saccharomycetales Debaryomycetaceae Candida/Lodderomyces clade Candida Candida albicans (Yeast) Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) |
| Enzyme Sequence | MQIKFLTTLATVLTSVAAMGDLAFNLGVKNDDGTCKDVSTFEGDLDFLKSHSKIIKTYAVSDCNTLQNLGPAAEAEGFQIQLGIWPNDDAHFEAEKEALQNYLPKISVSTIKIFLVGSEALYREDLTASELASKINEIKDLVKGIKDKNGKSYSSVPVGTVDSWNVLVDGASKPAIDAADVVYSNSFSYWQKNSQANASYSLFDDVMQALQTLQTAKGSTDIEFWVGETGWPTDGSSYGDSVPSVENAADQWQKGICALRAWGINVAVYEAFDEAWKPDTSGTSSVEKHWGVWQSDKTLKYSIDCKFN |
| Enzyme Length | 308 |
| Uniprot Accession Number | Q5AMT2 |
| Absorption | |
| Active Site | ACT_SITE 119; /note=Proton donor; /evidence=ECO:0000250|UniProtKB:O22317; ACT_SITE 228; /note=Nucleophile; /evidence=ECO:0000250|UniProtKB:O22317 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Successive hydrolysis of beta-D-glucose units from the non-reducing ends of (1->3)-beta-D-glucans, releasing alpha-glucose.; EC=3.2.1.58; Evidence={ECO:0000269|PubMed:7851411}; |
| DNA Binding | |
| EC Number | 3.2.1.58 |
| Enzyme Function | FUNCTION: Cell wall glucan 1,3-beta-glucosidase involved in cell wall biosynthesis and virulence. Crucial for delivery of beta-1,3-glucan to the biofilm matrix and for accumulation of mature matrix biomass. Plays a role as a major antigen in human systemic candidiasis patients. {ECO:0000269|PubMed:22876186, ECO:0000269|PubMed:7851411, ECO:0000269|PubMed:9043114}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Glycosylation (1); Signal peptide (1) |
| Keywords | Cell wall;Cell wall biogenesis/degradation;Cytoplasm;Direct protein sequencing;Glycoprotein;Glycosidase;Hydrolase;Reference proteome;Secreted;Signal;Virulence |
| Interact With | |
| Induction | INDUCTION: Induced during biofilm formation and by fluconazole and micafungin. Expression is also regulated by RCK2. {ECO:0000269|PubMed:15820985, ECO:0000269|PubMed:19013773, ECO:0000269|PubMed:19527170, ECO:0000269|PubMed:20402792}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted, cell wall {ECO:0000269|PubMed:19013773}. Cytoplasm {ECO:0000269|PubMed:19013773}. Note=Tightly bound to cell wall. A fraction of unprecessed protein is found in the cytoplasm. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..18; /evidence=ECO:0000269|PubMed:19013773 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 33,670 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |