| IED ID | IndEnz0011000255 | 
| Enzyme Type ID | glucanase000255 | 
| Protein Name | 
                        
                            
                                Glucan endo-1,3-beta-glucosidase  EC 3.2.1.39 1- 3 -beta-glucan endohydrolase 1- 3 -beta-glucanase Beta-1,3-endoglucanase Fragment  | 
                    
| Gene Name | |
| Organism | Vitis rotundifolia (Muscadine grape) | 
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids rosids incertae sedis Vitales Vitaceae Viteae Vitis Vitis rotundifolia (Muscadine grape) | 
| Enzyme Sequence | NIFNAISAAGLGNQIKVSTAIDTGVLGTSYPPSK | 
| Enzyme Length | 34 | 
| Uniprot Accession Number | P86102 | 
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Hydrolysis of (1->3)-beta-D-glucosidic linkages in (1->3)-beta-D-glucans.; EC=3.2.1.39; Evidence={ECO:0000250|UniProtKB:Q03773}; | 
| DNA Binding | |
| EC Number | 3.2.1.39 | 
| Enzyme Function | FUNCTION: Is thought to be an important plant defense-related product against fungal pathogens. {ECO:0000305}. | 
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Non-terminal residue (2) | 
| Keywords | Direct protein sequencing;Glycosidase;Hydrolase;Plant defense | 
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - | 
| Mapped Pubmed ID | - | 
| Motif | |
| Gene Encoded By | |
| Mass | 3,406 | 
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |