| IED ID | IndEnz0011000258 |
| Enzyme Type ID | glucanase000258 |
| Protein Name |
Glucan endo-1,3-beta-glucosidase, acidic isoform PR-O EC 3.2.1.39 1- 3 -beta-glucan endohydrolase 1- 3 -beta-glucanase Beta-1,3-endoglucanase PR-37 Fragment |
| Gene Name | PR0 |
| Organism | Nicotiana tabacum (Common tobacco) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Solanaceae Nicotianoideae Nicotianeae Nicotiana Nicotiana tabacum (Common tobacco) |
| Enzyme Sequence | NSFINPIIQFLARNNLPLLANVYPYFGHIYNTADVPLSYALFTQQEANPAGYQNLFDALLDSMYFAVEKAGGPNVEIIVSESGWPSEGNSAATIENAQTYYRNLIDHVKRGAGTPKKPGKTIETYLFAMFDENDKKGEITEKHFGLFSPDQRAKYQLNFN |
| Enzyme Length | 160 |
| Uniprot Accession Number | P52397 |
| Absorption | |
| Active Site | ACT_SITE 81; /note=Nucleophile; /evidence=ECO:0000250|UniProtKB:O22317 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Hydrolysis of (1->3)-beta-D-glucosidic linkages in (1->3)-beta-D-glucans.; EC=3.2.1.39; |
| DNA Binding | |
| EC Number | 3.2.1.39 |
| Enzyme Function | FUNCTION: Implicated in the defense of plants against pathogens. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Non-terminal residue (1); Sequence conflict (2) |
| Keywords | Direct protein sequencing;Glycosidase;Hydrolase;Plant defense;Reference proteome;Secreted |
| Interact With | |
| Induction | INDUCTION: Not found in healthy tissues, but accumulates to high levels in the extracellular compartment of leaves in response to pathogen infection or treatment with salicylic acid. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted, extracellular space. |
| Modified Residue | |
| Post Translational Modification | PTM: The N-terminus is blocked. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 17,980 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |