| IED ID | IndEnz0011000292 |
| Enzyme Type ID | glucanase000292 |
| Protein Name |
Glucan 1,3-beta-glucosidase EC 3.2.1.58 Exo-1,3-beta-glucanase Fragments |
| Gene Name | |
| Organism | Pseudotsuga menziesii (Douglas-fir) (Abies menziesii) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Acrogymnospermae Pinopsida Pinidae Conifers I Pinales Pinaceae Pseudotsuga Pseudotsuga menziesii (Douglas-fir) (Abies menziesii) |
| Enzyme Sequence | ATPILRNHLGVIIDLHAAPGSQNPWEHYAKVQMDVYGQAT |
| Enzyme Length | 40 |
| Uniprot Accession Number | P85924 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Successive hydrolysis of beta-D-glucose units from the non-reducing ends of (1->3)-beta-D-glucans, releasing alpha-glucose.; EC=3.2.1.58; Evidence={ECO:0000250|UniProtKB:Q7Z9L3}; |
| DNA Binding | |
| EC Number | 3.2.1.58 |
| Enzyme Function | |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Non-adjacent residues (2); Non-terminal residue (2) |
| Keywords | Carbohydrate metabolism;Cell wall biogenesis/degradation;Glycosidase;Hydrolase;Polysaccharide degradation;Secreted |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:Q7Z9L3}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 4,413 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |