| IED ID | IndEnz0011000351 |
| Enzyme Type ID | glucanase000351 |
| Protein Name |
Minor endoglucanase Y EC 3.2.1.4 Cellulase Y Endo-1,4-beta-glucanase Y EGY |
| Gene Name | celY Dda3937_01994 |
| Organism | Dickeya dadantii (strain 3937) (Erwinia chrysanthemi (strain 3937)) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Pectobacteriaceae Dickeya Dickeya dadantii Dickeya dadantii (strain 3937) (Erwinia chrysanthemi (strain 3937)) |
| Enzyme Sequence | MGKPMWRCWALMLMVWFSASATAANGWEIYKSRFMTTDGRIQDTGNKNVSHTEGQGFAMLMAVHYDDRIAFDNLWNWTQSHLRNTTSGLFYWRYDPSAANPVVDKNNASDGDVLIAWALLKAGNKWQDNRYLQASDSIQKAIIASNIIQFAGRTVMLPGAYGFNKNSYVILNPSYFLFPAWRDFANRSHLQVWRQLIDDSLSLVGEMRFGQVGLPTDWAALNADGSMAPATAWPSRFSYDAIRIPLYLYWYDAKTTALVPFQLYWRNYPRLTTPAWVDVLSSNTATYNMQGGLLAVRDLTMGNLDGLSDLPGASEDYYSSSLRLLVMLARGK |
| Enzyme Length | 332 |
| Uniprot Accession Number | P27032 |
| Absorption | |
| Active Site | ACT_SITE 53; /note=Proton donor; /evidence=ECO:0000250; ACT_SITE 110; /note=Nucleophile; /evidence=ECO:0000255|PROSITE-ProRule:PRU10058 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Endohydrolysis of (1->4)-beta-D-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.; EC=3.2.1.4; |
| DNA Binding | |
| EC Number | 3.2.1.4 |
| Enzyme Function | FUNCTION: Represents only 3% of the global cellulase activity. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Signal peptide (1) |
| Keywords | Carbohydrate metabolism;Cellulose degradation;Direct protein sequencing;Glycosidase;Hydrolase;Polysaccharide degradation;Reference proteome;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..23; /evidence=ECO:0000269|PubMed:1937031 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 37,593 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |