| IED ID | IndEnz0011000412 |
| Enzyme Type ID | glucanase000412 |
| Protein Name |
Glucan endo-1,3-beta-glucosidase EC 3.2.1.39 1- 3 -beta-glucan endohydrolase 1- 3 -beta-glucanase Allergen Pru a 2 Beta-1,3-endoglucanase Thaumatin-like protein TLP allergen Pru av 2 |
| Gene Name | |
| Organism | Prunus avium (Cherry) (Cerasus avium) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids fabids Rosales Rosaceae Amygdaloideae Amygdaleae Prunus Prunus avium (Cherry) (Cerasus avium) |
| Enzyme Sequence | MMKTLVVVLSLSLTILSFGGAHAATISFKNNCPYMVWPGTLTSDQKPQLSTTGFELASQASFQLDTPVPWNGRFWARTGCSTDASGKFVCATADCASGQVMCNGNGAIPPATLAEFNIPAGGGQDFYDVSLVDGFNLPMSVTPQGGTGDCKTASCPANVNAVCPSELQKKGSDGSVVACLSACVKFGTPQYCCTPPQNTPETCPPTNYSEIFHNACPDAYSYAYDDKRGTFTCNGGPNYAITFCP |
| Enzyme Length | 245 |
| Uniprot Accession Number | P50694 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Hydrolysis of (1->3)-beta-D-glucosidic linkages in (1->3)-beta-D-glucans.; EC=3.2.1.39; Evidence={ECO:0000269|PubMed:16499648}; |
| DNA Binding | |
| EC Number | 3.2.1.39 |
| Enzyme Function | |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (16); Chain (1); Disulfide bond (8); Helix (6); Signal peptide (1); Turn (2) |
| Keywords | 3D-structure;Allergen;Direct protein sequencing;Disulfide bond;Glycosidase;Hydrolase;IgE-binding protein;Reference proteome;Secreted;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..23; /evidence=ECO:0000269|PubMed:9623505 |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 2AHN; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 25,707 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |