| IED ID | IndEnz0011000425 |
| Enzyme Type ID | glucanase000425 |
| Protein Name |
Probable glucan endo-1,3-beta-glucosidase btgC EC 3.2.1.39 Endo-1,3-beta-glucanase btgC Laminarinase btgC |
| Gene Name | btgC AFLA_099780 |
| Organism | Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta Eurotiomycetes Eurotiomycetidae Eurotiales (green and blue molds) Aspergillaceae Aspergillus Aspergillus subgen. Circumdati Aspergillus flavus Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) |
| Enzyme Sequence | MSGPHRSFSFNQGDDGAGDAGDVSPIRSQEGHFMNSPPRHNDVSPVSARSQAMGSSPSSGFLSAHEHGDRGWGQNSGHTQAMRTNSTTPGMDNLGPAAVGGGISGIALGVANSHNRQSGIDAFRDTDGRNLPAERGYNTTGSDNPYVPTPPGGGSHGSAENLRPRDSYGSNVALGAAAAPAGQLTPGGSNPSQRSLFDSPYQGVGAMDAGPYQRQSAYSAAGDYPLVINPDEIADDGDDGFTPVPNGKSASSNARAIPAAAAGGAAGGGLFGLFKSKKADNPSYGPVPGAGLEAGEKSRWVKPTPGGGSRKRGWIVGLALAFIVVGAIVGGAVGGTLGNRENEAPDTTKSASSDTESNGDLNKDSSEIKDLMNNPDLHKVFPGMDYTPWGVQYPLCLKYPPSQNNVTRDVAVLSQLTNTVRLYGTDCNQTEMVLHAIDRLELKDMKVWLGVWIDSNDTTNDRQIKQLYKVLDDTKDISIFKGAIVGNEALYRAGNDIASAKKKLISYMDDVRNHFKEKNYDLPIATSDLGDNWKEDLVTATDLVMSNVHPFFAGVTAKEAAGWTWNFWNQNDVPLTKGTNKKQVISEVGWPSGGGNDCGSNNKCTDDTSGSVAGIDEMNQFMSDWICQALENGTDYFWFEAFDEPWKVQYNTKDENWEDKWGLMDAARKLKPGLKIPDCGGKTAA |
| Enzyme Length | 685 |
| Uniprot Accession Number | B8NTP7 |
| Absorption | |
| Active Site | ACT_SITE 488; /note=Proton donor; /evidence=ECO:0000250|UniProtKB:O22317; ACT_SITE 587; /note=Nucleophile; /evidence=ECO:0000250|UniProtKB:O22317 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Hydrolysis of (1->3)-beta-D-glucosidic linkages in (1->3)-beta-D-glucans.; EC=3.2.1.39; |
| DNA Binding | |
| EC Number | 3.2.1.39 |
| Enzyme Function | FUNCTION: Glucanases play a role in cell expansion during growth, in cell-cell fusion during mating, and in spore release during sporulation. This enzyme may be involved in beta-glucan degradation. Active on laminarin and lichenan (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Compositional bias (4); Glycosylation (4); Region (4); Topological domain (2); Transmembrane (1) |
| Keywords | Carbohydrate metabolism;Cell membrane;Cell wall biogenesis/degradation;Glycoprotein;Hydrolase;Membrane;Polysaccharide degradation;Reference proteome;Signal-anchor;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell membrane {ECO:0000250}; Single-pass type II membrane protein {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 72,800 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |