| IED ID | IndEnz0011000431 |
| Enzyme Type ID | glucanase000431 |
| Protein Name |
Xyloglucan endotransglucosylase protein 1 XET protein 1 EC 2.4.1.207 DkXTH1 Xyloglucan endotransglucosylase/hydrolase protein 1 XTH protein 1 |
| Gene Name | XTH1 |
| Organism | Diospyros kaki (Kaki persimmon) (Diospyros chinensis) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae asterids Ericales Ebenaceae Diospyros Diospyros kaki (Kaki persimmon) (Diospyros chinensis) |
| Enzyme Sequence | MAFMSFINGFSTLFLVALLASSMMAAKGGNFYQDFDVTWGDHRAKIFNGGQLLSLSLDKTSGSGFRSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYIVHTNVFTQGKGNREQQFYLWFDPTRNFHTYSVVWNPRQIIFLIDNTPIRVFKNAESIGVPFPKNQPMRIYSSLWNADDWATRGGLVKTDWTKAPFTAYYRNFNAKTCSGACTESFGDGAWQSQELDAHSRRRLRWVQKNFMIYNYCTDLKRFPEGLPKECQRRSRFL |
| Enzyme Length | 287 |
| Uniprot Accession Number | G5DAC6 |
| Absorption | |
| Active Site | ACT_SITE 105; /note="Nucleophile"; /evidence="ECO:0000255|PIRSR:PIRSR005604-1, ECO:0000255|PROSITE-ProRule:PRU10064"; ACT_SITE 109; /note="Proton donor"; /evidence="ECO:0000255|PIRSR:PIRSR005604-1, ECO:0000255|PROSITE-ProRule:PRU10064" |
| Activity Regulation | |
| Binding Site | BINDING 109; /note=Xyloglucan; /evidence=ECO:0000250|UniProtKB:Q8GZD5; BINDING 203; /note=Xyloglucan; via carbonyl oxygen; /evidence=ECO:0000250|UniProtKB:Q8GZD5; BINDING 271; /note=Xyloglucan; /evidence=ECO:0000250|UniProtKB:Q8GZD5 |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Breaks a beta-(1->4) bond in the backbone of a xyloglucan and transfers the xyloglucanyl segment on to O-4 of the non-reducing terminal glucose residue of an acceptor, which can be a xyloglucan or an oligosaccharide of xyloglucan.; EC=2.4.1.207; Evidence={ECO:0000255|RuleBase:RU361120, ECO:0000269|PubMed:25849978}; |
| DNA Binding | |
| EC Number | 2.4.1.207 |
| Enzyme Function | FUNCTION: Catalyzes xyloglucan endotransglycosylation (XET). Cleaves and religates xyloglucan polymers. Does not catalyze xyloglucan endohydrolysis (XEH) (PubMed:25849978). Overexpression in Arabidopsis transgenic plants results in elevated tolerance to abiotic stress, such as salt, ABA (abscisic acid) and drought stresses, and in the production of wider leaves. Overexpression in transgenic tomato plants slows down fruit ripening and softening, and the plants produce larger fruits. Both transgenic plants have larger and more irregular cells. Moreover, the fruits of the transgenic tomato have higher density of cell wall and intercellular spaces. May provide cells with more strength and thickness to maintain structural integrity (PubMed:28155115). Probably involved in cell wall assembly and synthesis in fast growing tissues and in the maintenance of firmness in mature fruits (PubMed:25849978, PubMed:28155115). {ECO:0000269|PubMed:25849978, ECO:0000269|PubMed:28155115}. |
| Temperature Dependency | |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is between 5-5.5. Loses activity rapidly when pH is lowered from 5 to 4. {ECO:0000269|PubMed:25849978}; |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Binding site (3); Chain (1); Disulfide bond (2); Domain (1); Glycosylation (1); Region (3); Signal peptide (1); Site (1) |
| Keywords | Apoplast;Cell wall;Cell wall biogenesis/degradation;Disulfide bond;Fruit ripening;Glycoprotein;Glycosidase;Glycosyltransferase;Hydrolase;Secreted;Signal;Transferase |
| Interact With | |
| Induction | INDUCTION: In fruits, expression is decreased by gibberellic acid (GA3) or 1-methylcyclopropene (1-MCP) at the beginning of storage (until day 6) (PubMed:23265513). Expression in harvested fruits is increased by low (0 degrees Celsius) temperature treatment, particularly at the end of storage (day 32) (PubMed:25849978). {ECO:0000269|PubMed:23265513, ECO:0000269|PubMed:25849978}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted, cell wall {ECO:0000255|RuleBase:RU361120, ECO:0000269|PubMed:25849978}. Secreted, extracellular space, apoplast {ECO:0000255|RuleBase:RU361120}. |
| Modified Residue | |
| Post Translational Modification | PTM: Contains at least one intrachain disulfide bond essential for its enzymatic activity. {ECO:0000255|RuleBase:RU361120}. |
| Signal Peptide | SIGNAL 1..28; /evidence=ECO:0000255|RuleBase:RU361120 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 32,903 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 2.4.1.207; |