| IED ID | IndEnz0011000433 |
| Enzyme Type ID | glucanase000433 |
| Protein Name |
Probable xyloglucan endotransglucosylase/hydrolase protein 27 At-XTH27 XTH-27 EC 2.4.1.207 |
| Gene Name | XTH27 EXGT-A3 At2g01850 T23K3.4 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | METLSRLLVFMSLFSGLVSGFALQNLPITSFEESYTQLFGDKNLFVHQDGKSVRLTLDERTGSGFVSNDYYLHGFFSASIKLPSDYTAGVVVAFYMSNGDMYEKNHDEIDFEFLGNIREKEWRVQTNIYGNGSTHSGREERYNLWFDPTEDFHQYSILWSDSHIIFFVDNVPIREVKRTAEMGGHFPSKPMSLYTTIWDGSKWATNGGKYGVNYKYAPYIARFSDLVLHGCPVDPIEQFPRCDEGAAEDMRAAQEITPSQRSKMDVFRRRLMTYSYCYDRARYNVALSECVVNPAEAQRLRVYDPVRFGGIPRRHRNGKHRSKRSRVDGTESI |
| Enzyme Length | 333 |
| Uniprot Accession Number | Q8LDS2 |
| Absorption | |
| Active Site | ACT_SITE 108; /note=Nucleophile; /evidence=ECO:0000250|UniProtKB:Q8GZD5; ACT_SITE 112; /note=Proton donor; /evidence=ECO:0000250|UniProtKB:Q8GZD5 |
| Activity Regulation | |
| Binding Site | BINDING 112; /note=Xyloglucan; /evidence=ECO:0000250|UniProtKB:Q8GZD5; BINDING 207; /note=Xyloglucan; via carbonyl oxygen; /evidence=ECO:0000250|UniProtKB:Q8GZD5; BINDING 282; /note=Xyloglucan; /evidence=ECO:0000250|UniProtKB:Q8GZD5 |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Breaks a beta-(1->4) bond in the backbone of a xyloglucan and transfers the xyloglucanyl segment on to O-4 of the non-reducing terminal glucose residue of an acceptor, which can be a xyloglucan or an oligosaccharide of xyloglucan.; EC=2.4.1.207; |
| DNA Binding | |
| EC Number | 2.4.1.207 |
| Enzyme Function | FUNCTION: Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues (By similarity). Required for cell wall modification during the development of tracheary elements. {ECO:0000250, ECO:0000269|PubMed:15860011}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Binding site (3); Chain (1); Disulfide bond (1); Domain (1); Glycosylation (1); Region (4); Sequence conflict (3); Signal peptide (1); Site (1) |
| Keywords | Apoplast;Cell wall;Cell wall biogenesis/degradation;Disulfide bond;Glycoprotein;Glycosidase;Hydrolase;Reference proteome;Secreted;Signal;Transferase |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted, cell wall {ECO:0000305}. Secreted, extracellular space, apoplast {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | PTM: Contains at least one intrachain disulfide bond essential for its enzymatic activity. {ECO:0000250}. |
| Signal Peptide | SIGNAL 1..20; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10406121; 11673616; 12805598; 15694452; 15720654; 18315867; 19139039; 27247031; |
| Motif | |
| Gene Encoded By | |
| Mass | 38,415 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |