| IED ID | IndEnz0011000434 |
| Enzyme Type ID | glucanase000434 |
| Protein Name |
Probable xyloglucan-specific endo-beta-1,4-glucanase A EC 3.2.1.151 Xyloglucanase A Xyloglucanendohydrolase A |
| Gene Name | xgeA ATEG_03755 |
| Organism | Aspergillus terreus (strain NIH 2624 / FGSC A1156) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta Eurotiomycetes Eurotiomycetidae Eurotiales (green and blue molds) Aspergillaceae Aspergillus Aspergillus subgen. Circumdati Aspergillus terreus Aspergillus terreus (strain NIH 2624 / FGSC A1156) |
| Enzyme Sequence | MKLSVLSLASLASAAALNAKVLTGKSLTRRADFCDQWGQVTTGNFILYNNLWGQGNADSGSQCTGLDSSSGNDSIAWHTSWSWSGGAGQVKSYANAAYVFTPKQLSALGSIPTSWSWKYTGSDIIANVAYDLFTSSTADGDNEYEIMIWLAALGGAGPISSTGSPVASPTVAGHSWDLYSGMNGQMQVYSFVASSQTESFSADLQEFIMYLQSNQGLPTSQYLVDVQAGTEPFSGSDATLTTSAYSVSVA |
| Enzyme Length | 250 |
| Uniprot Accession Number | Q0CRC9 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Xyloglucan + H(2)O = xyloglucan oligosaccharides.; EC=3.2.1.151; |
| DNA Binding | |
| EC Number | 3.2.1.151 |
| Enzyme Function | FUNCTION: Catalyzes endohydrolysis of 1,4-beta-D-glucosidic linkages in xyloglucan with retention of the beta-configuration of the glycosyl residues. Specific for xyloglucan and does not hydrolyze other cell wall components (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Erroneous gene model prediction (1); Glycosylation (1); Signal peptide (1) |
| Keywords | Carbohydrate metabolism;Cell wall biogenesis/degradation;Glycoprotein;Glycosidase;Hydrolase;Polysaccharide degradation;Reference proteome;Secreted;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..19; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 26,301 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |