| IED ID | IndEnz0011000439 |
| Enzyme Type ID | glucanase000439 |
| Protein Name |
Xyloglucan endotransglucosylase/hydrolase protein 22 At-XTH22 XTH-22 EC 2.4.1.207 Touch protein 4 |
| Gene Name | XTH22 TCH4 At5g57560 MUA2.13 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MAITYLLPLFLSLIITSSVSANFQRDVEITWGDGRGQIKNNGELLTLSLDKSSGSGFQSKNEYLFGKVSMQMKLVPGNSAGTVTTLYLKSPGTTWDEIDFEFLGNSSGEPYTLHTNVYTQGKGDKEQQFKLWFDPTANFHTYTILWNPQRIIFTVDGTPIREFKNMESLGTLFPKNKPMRMYSSLWNADDWATRGGLVKTDWSKAPFTASYRGFQQEACVWSNGKSSCPNASKQGTTTGSWLSQELDSTAQQRMRWVQRNYMIYNYCTDAKRFPQGLPKECLAA |
| Enzyme Length | 284 |
| Uniprot Accession Number | Q38857 |
| Absorption | |
| Active Site | ACT_SITE 97; /note=Nucleophile; /evidence=ECO:0000255|PROSITE-ProRule:PRU10064; ACT_SITE 101; /note=Proton donor; /evidence=ECO:0000255|PROSITE-ProRule:PRU10064 |
| Activity Regulation | |
| Binding Site | BINDING 101; /note=Xyloglucan; /evidence=ECO:0000250|UniProtKB:Q8GZD5; BINDING 195; /note=Xyloglucan; via carbonyl oxygen; /evidence=ECO:0000250|UniProtKB:Q8GZD5; BINDING 272; /note=Xyloglucan; /evidence=ECO:0000250|UniProtKB:Q8GZD5 |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Breaks a beta-(1->4) bond in the backbone of a xyloglucan and transfers the xyloglucanyl segment on to O-4 of the non-reducing terminal glucose residue of an acceptor, which can be a xyloglucan or an oligosaccharide of xyloglucan.; EC=2.4.1.207; Evidence={ECO:0000269|PubMed:10406121}; |
| DNA Binding | |
| EC Number | 2.4.1.207 |
| Enzyme Function | FUNCTION: Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues. Its induction in case of mechanical stress, suggests that it may contribute in the adaptive changes in morphogenesis by being recruited to alter tissues tensil strength, or flexibility, enabling adaptation to mechanically stressful environments. {ECO:0000269|PubMed:7580251}. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Optimum temperature from 12 to 18 degrees Celsius. Cold tolerant.; |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 6.0-6.5.; |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Binding site (3); Chain (1); Disulfide bond (2); Domain (1); Glycosylation (2); Mutagenesis (2); Region (3); Signal peptide (1); Site (1) |
| Keywords | Apoplast;Cell wall;Cell wall biogenesis/degradation;Disulfide bond;Glycoprotein;Glycosidase;Hydrolase;Reference proteome;Secreted;Signal;Transferase |
| Interact With | |
| Induction | INDUCTION: In response to mechanical perturbations such as wind or touch. Induced by auxin and brassinolide. {ECO:0000269|PubMed:11673616, ECO:0000269|PubMed:7580251, ECO:0000269|PubMed:8696366}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted, cell wall {ECO:0000305}. Secreted, extracellular space, apoplast {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | PTM: Contains at least one intrachain disulfide bond essential for its enzymatic activity.; PTM: N-glycosylated; essential for its enzymatic activity. {ECO:0000269|PubMed:10406121, ECO:0000269|PubMed:9753780}. |
| Signal Peptide | SIGNAL 1..21; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 11311129; 12376643; 15773850; 16214899; 18334669; 18487153; 19291320; 20507939; 20688978; 2302732; 23682113; 24620000; 28443615; 28479230; 28627464; 30537160; 31519798; 35163179; 8756505; |
| Motif | |
| Gene Encoded By | |
| Mass | 32,093 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |