| IED ID | IndEnz0011000444 |
| Enzyme Type ID | glucanase000444 |
| Protein Name |
Xyloglucan endotransglucosylase/hydrolase protein 15 At-XTH15 XTH-15 EC 2.4.1.207 EC 3.2.1.151 |
| Gene Name | XTH15 XTR7 At4g14130 dl3105c FCAALL.173 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MGPSSSLTTIVATVLLVTLFGSAYASNFFDEFDLTWGDHRGKIFNGGNMLSLSLDQVSGSGFKSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQGATHDEIDFEFLGNETGKPYVLHTNVFAQGKGDREQQFYLWFDPTKNFHTYSIVWRPQHIIFLVDNLPIRVFNNAEKLGVPFPKSQPMRIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRGFNAAACTASSGCDPKFKSSFGDGKLQVATELNAYGRRRLRWVQKYFMIYNYCSDLKRFPRGFPPECKKSRV |
| Enzyme Length | 289 |
| Uniprot Accession Number | Q38911 |
| Absorption | |
| Active Site | ACT_SITE 102; /note=Nucleophile; /evidence=ECO:0000255|PROSITE-ProRule:PRU10064; ACT_SITE 106; /note=Proton donor; /evidence=ECO:0000255|PROSITE-ProRule:PRU10064 |
| Activity Regulation | |
| Binding Site | BINDING 106; /note=Xyloglucan; /evidence=ECO:0000250|UniProtKB:Q8GZD5; BINDING 200; /note=Xyloglucan; via carbonyl oxygen; /evidence=ECO:0000250|UniProtKB:Q8GZD5; BINDING 275; /note=Xyloglucan; /evidence=ECO:0000250|UniProtKB:Q8GZD5 |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Breaks a beta-(1->4) bond in the backbone of a xyloglucan and transfers the xyloglucanyl segment on to O-4 of the non-reducing terminal glucose residue of an acceptor, which can be a xyloglucan or an oligosaccharide of xyloglucan.; EC=2.4.1.207; Evidence={ECO:0000269|PubMed:25446234}; CATALYTIC ACTIVITY: Reaction=Xyloglucan + H(2)O = xyloglucan oligosaccharides.; EC=3.2.1.151; Evidence={ECO:0000269|PubMed:25446234}; |
| DNA Binding | |
| EC Number | 2.4.1.207; 3.2.1.151 |
| Enzyme Function | FUNCTION: Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues. Has a high XET activity, but little or no XEH activity in vitro. Acceptor preferences are XXXGol > XLLGol = XLFGol > XXLGol > XXFGol. {ECO:0000269|PubMed:25446234}. |
| Temperature Dependency | |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 6 for the XET activity. {ECO:0000269|PubMed:25446234}; |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Binding site (3); Chain (1); Disulfide bond (2); Domain (1); Glycosylation (1); Region (3); Sequence conflict (2); Signal peptide (1); Site (1) |
| Keywords | Apoplast;Cell wall;Cell wall biogenesis/degradation;Disulfide bond;Glycoprotein;Glycosidase;Hydrolase;Reference proteome;Secreted;Signal;Transferase |
| Interact With | |
| Induction | INDUCTION: Down-regulated by auxin (PubMed:11673616). Down-regulated by aluminum (PubMed:21285327). Repressed by far-red light (FRc) (PubMed:14645728). {ECO:0000269|PubMed:11673616, ECO:0000269|PubMed:14645728, ECO:0000269|PubMed:21285327}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted, cell wall {ECO:0000305}. Secreted, extracellular space, apoplast {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | PTM: Contains at least one intrachain disulfide bond essential for its enzymatic activity. {ECO:0000250}. |
| Signal Peptide | SIGNAL 1..25; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 12376638; 12538522; 12620105; 12773641; 12777046; 12795706; 12912986; 12913156; 14558660; 14966217; 15047898; 15319476; 15341629; 15720654; 15772289; 16463051; 16514558; 16648215; 18055584; 18252252; 18684332; 19000166; 19291320; 20688978; |
| Motif | |
| Gene Encoded By | |
| Mass | 32,687 |
| Kinetics | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=31 uM for XXXGol {ECO:0000269|PubMed:25446234}; Note=KM for xyloglucan as donor substrate is 2.87 mg/ml. KM is quoted in mg/ml, not uM, because XTHs are able to utilise any segment of the polysaccharide chain equally well, not just one site per molecule as with the acceptor. {ECO:0000269|PubMed:25446234}; |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 2.4.1.207;3.2.1.151; |