IED ID | IndEnz0011000452 |
Enzyme Type ID | glucanase000452 |
Protein Name |
Probable xyloglucan-specific endo-beta-1,4-glucanase A EC 3.2.1.151 Xyloglucanase A Xyloglucanendohydrolase A |
Gene Name | xgeA AFUB_005070 |
Organism | Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) (Aspergillus fumigatus) |
Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta Eurotiomycetes Eurotiomycetidae Eurotiales (green and blue molds) Aspergillaceae Aspergillus Aspergillus subgen. Fumigati Neosartorya fumigata (Aspergillus fumigatus) Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) (Aspergillus fumigatus) |
Enzyme Sequence | MKLSLSVALSLAAATAQAATQFCDQWGSVTEGNYILYNNLWGQAQATSGSQCTTFESLSGNTIVWNTKWSWSGGQGQVKSFANAALQFTPKKLSSVKSIDSTWKWNYSGSNIVADVAYDMFLSTSPGGDHNYEIMVWLGALGGAGPISSTGSPIATPTVAGIKFNLYLGPNGSMQVYSFVAQSTTNSFSGDMRDFFTYLESNQGLSSDLYLVDVQAGTEPFSGSNAVFTVSDYSVSVA |
Enzyme Length | 238 |
Uniprot Accession Number | B0XNQ1 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | CATALYTIC ACTIVITY: Reaction=Xyloglucan + H(2)O = xyloglucan oligosaccharides.; EC=3.2.1.151; |
DNA Binding | |
EC Number | 3.2.1.151 |
Enzyme Function | FUNCTION: Catalyzes endohydrolysis of 1,4-beta-D-glucosidic linkages in xyloglucan with retention of the beta-configuration of the glycosyl residues. Specific for xyloglucan and does not hydrolyze other cell wall components (By similarity). {ECO:0000250}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Chain (1); Glycosylation (2); Signal peptide (1) |
Keywords | Carbohydrate metabolism;Cell wall biogenesis/degradation;Glycoprotein;Glycosidase;Hydrolase;Polysaccharide degradation;Secreted;Signal |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305}. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | SIGNAL 1..18; /evidence=ECO:0000255 |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 25,298 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |