| IED ID | IndEnz0011000454 |
| Enzyme Type ID | glucanase000454 |
| Protein Name |
Xyloglucan endotransglucosylase protein 7 XET protein 7 EC 2.4.1.207 DkXTH7 Xyloglucan endotransglucosylase/hydrolase protein 7 XTH protein 7 |
| Gene Name | XTH7 |
| Organism | Diospyros kaki (Kaki persimmon) (Diospyros chinensis) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae asterids Ericales Ebenaceae Diospyros Diospyros kaki (Kaki persimmon) (Diospyros chinensis) |
| Enzyme Sequence | MNAEGGNLHREFEITWGDGRARIHNNGGLLTLSLDRASGSGFRSKNEYLFGRIEIQIKLVAGNSAGTVATYYLSSEGPTHDEIDFEFLGNSSGEPYTLHTNVFSQGKGNREQQFFLWFDPTMDFHTYTILWNPQRIIFYVDETPIREFKNLERHGIPFPRSQAMRVYSSMWNADDWATRGGLVKTDWTKAPFTASYRSYKADACVWSGEASSCGSQDSNPSDKWWMTEELNATRMKRLRWVQKKYMVYNYCVDKMRFPEGLAPECNIS |
| Enzyme Length | 268 |
| Uniprot Accession Number | A0A067XR63 |
| Absorption | |
| Active Site | ACT_SITE 82; /note="Nucleophile"; /evidence="ECO:0000255|PIRSR:PIRSR005604-1, ECO:0000255|PROSITE-ProRule:PRU10064"; ACT_SITE 86; /note="Proton donor"; /evidence="ECO:0000255|PIRSR:PIRSR005604-1, ECO:0000255|PROSITE-ProRule:PRU10064" |
| Activity Regulation | |
| Binding Site | BINDING 86; /note=Xyloglucan; /evidence=ECO:0000250|UniProtKB:Q8GZD5; BINDING 180; /note=Xyloglucan; via carbonyl oxygen; /evidence=ECO:0000250|UniProtKB:Q8GZD5; BINDING 256; /note=Xyloglucan; /evidence=ECO:0000250|UniProtKB:Q8GZD5 |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Breaks a beta-(1->4) bond in the backbone of a xyloglucan and transfers the xyloglucanyl segment on to O-4 of the non-reducing terminal glucose residue of an acceptor, which can be a xyloglucan or an oligosaccharide of xyloglucan.; EC=2.4.1.207; Evidence={ECO:0000255|RuleBase:RU361120, ECO:0000269|PubMed:27242828}; |
| DNA Binding | |
| EC Number | 2.4.1.207 |
| Enzyme Function | FUNCTION: Catalyzes xyloglucan endotransglycosylation (XET). Cleaves and religates xyloglucan polymers. Does not catalyze xyloglucan endohydrolysis (XEH). Probably involved in cell wall assembly and synthesis in fast growing tissues and in the maintenance of firmness in mature fruits. {ECO:0000269|PubMed:27242828}. |
| Temperature Dependency | |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is between 5-6. Activity decreases sharply when the pH is lowered from 5 to 4. {ECO:0000269|PubMed:27242828}; |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Binding site (3); Chain (1); Disulfide bond (2); Domain (1); Glycosylation (1); Region (3); Site (1) |
| Keywords | Cell wall biogenesis/degradation;Cytoplasm;Disulfide bond;Fruit ripening;Glycoprotein;Glycosidase;Glycosyltransferase;Hydrolase;Transferase |
| Interact With | |
| Induction | INDUCTION: In fruits, up-regulated by gibberellic acid (GA3) or by cold treatment during storage. {ECO:0000269|PubMed:27242828}. |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:27242828}. Note=Dispersed throughout the cell. {ECO:0000269|PubMed:27242828}. |
| Modified Residue | |
| Post Translational Modification | PTM: Contains at least one intrachain disulfide bond essential for its enzymatic activity. {ECO:0000255|RuleBase:RU361120}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 30,834 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 2.4.1.207;3.2.1.151; |