| IED ID | IndEnz0011000455 |
| Enzyme Type ID | glucanase000455 |
| Protein Name |
Thaumatin-like protein 1 EC 3.2.1.- Acidic thaumatin-like protein Beta-1,3-glucanase Thaumatin-like protein 1b |
| Gene Name | TLP1 TLP 1b |
| Organism | Manilkara zapota (Sapodilla plum) (Achras zapota) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae asterids Ericales Sapotaceae Sapotoideae Manilkara Manilkara zapota (Sapodilla plum) (Achras zapota) |
| Enzyme Sequence | ATFDVVNQCTFTVWAGASPGGGKQLDQGQTWTITVAPGSTKARIWGRTGCNFDANGQGKCQTGDCNGLLQCQGYGSPPNTLAEFSLNQPNNLDYVDISLVDGFNIPMDFSPAAAGVCKDIRCATDITAQCPAELQAPGGCNNPCTVYKTNEYCCTNGQGTCGPTALSKFFKDRCPDAYSYPQDDPTSLFTCPAGTNYKVVFCPNLDA |
| Enzyme Length | 207 |
| Uniprot Accession Number | G5DC91 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.2.1.- |
| Enzyme Function | FUNCTION: Acidic thaumatin-like protein. Exhibits weak beta-1,3-glucanase activity with laminarin as substrate. {ECO:0000269|PubMed:24060761}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (8) |
| Keywords | Allergen;Direct protein sequencing;Disulfide bond;Glycosidase;Hydrolase;Pathogenesis-related protein;Plant defense;Secreted |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | PTM: Not glycosylated. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 21,922 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |