| IED ID | IndEnz0011000465 |
| Enzyme Type ID | glucanase000465 |
| Protein Name |
Probable xyloglucan endotransglucosylase/hydrolase protein 26 At-XTH26 XTH-26 EC 2.4.1.207 |
| Gene Name | XTH26 XTR18 At4g28850 F16A16.40 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MAGLQAKTLMFVLAAALATLGRTFVEADFSKNFIVTWGKDHMFMNGTNLRLVLDKSAGSAIKSKVAHLFGSVEMLIKLVPGNSAGTVAAYYLSSTGSTHDEIDFEFLGNATGQPYTIHTNLYAQGKGNREQQFRPWFNPTNGFHNYTIHWNPSEVVWFVDGTPIRVFRNYESEGIAYPNKQGMKVFASLWNAEDWATQGGRVKTNWTLAPFVAEGRRYKARACLWKGSVSIKQCVDPTIRSNWWTSPSFSQLTASQLTKMQKIRDGFMIYDYCKDTNRFKGVMPPECSKKQF |
| Enzyme Length | 292 |
| Uniprot Accession Number | Q9SVV2 |
| Absorption | |
| Active Site | ACT_SITE 101; /note=Nucleophile; /evidence=ECO:0000255|PROSITE-ProRule:PRU10064; ACT_SITE 105; /note=Proton donor; /evidence=ECO:0000255|PROSITE-ProRule:PRU10064 |
| Activity Regulation | |
| Binding Site | BINDING 105; /note=Xyloglucan; /evidence=ECO:0000250|UniProtKB:Q8GZD5; BINDING 199; /note=Xyloglucan; via carbonyl oxygen; /evidence=ECO:0000250|UniProtKB:Q8GZD5; BINDING 278; /note=Xyloglucan; /evidence=ECO:0000250|UniProtKB:Q8GZD5 |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Breaks a beta-(1->4) bond in the backbone of a xyloglucan and transfers the xyloglucanyl segment on to O-4 of the non-reducing terminal glucose residue of an acceptor, which can be a xyloglucan or an oligosaccharide of xyloglucan.; EC=2.4.1.207; |
| DNA Binding | |
| EC Number | 2.4.1.207 |
| Enzyme Function | FUNCTION: Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Binding site (3); Chain (1); Disulfide bond (2); Domain (1); Glycosylation (4); Region (3); Signal peptide (1); Site (1) |
| Keywords | Apoplast;Cell wall;Cell wall biogenesis/degradation;Disulfide bond;Glycoprotein;Glycosidase;Hydrolase;Reference proteome;Secreted;Signal;Transferase |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted, cell wall {ECO:0000305}. Secreted, extracellular space, apoplast {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | PTM: Contains at least one intrachain disulfide bond essential for its enzymatic activity. {ECO:0000250}. |
| Signal Peptide | SIGNAL 1..27; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 11673616; 14690510; 15047898; 15720654; 16258017; 16367956; 16648215; 16766693; 17579518; 18725200; 18772308; 19635745; 22253603; 27457991; |
| Motif | |
| Gene Encoded By | |
| Mass | 32,924 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |