| IED ID | IndEnz0011000468 |
| Enzyme Type ID | glucanase000468 |
| Protein Name |
Xyloglucan endotransglucosylase protein 2 XET protein 2 EC 2.4.1.207 DkXTH2 Xyloglucan endotransglucosylase/hydrolase protein 2 XTH protein 2 |
| Gene Name | XTH2 |
| Organism | Diospyros kaki (Kaki persimmon) (Diospyros chinensis) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae asterids Ericales Ebenaceae Diospyros Diospyros kaki (Kaki persimmon) (Diospyros chinensis) |
| Enzyme Sequence | MAMGTHFGGLWLALLCMVSATMGAVPRKPVDVPFGRNYVPTWAFDHIKYFNGGSQIQLSLDKYTGTGFQSKGSYLFGHFSMQIKMVPGDSAGTVTAFYLSSQNSEHDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIFLWFDPTKEYHSYSVLWNLFLIIFFVDDVPIRVFKNSKDLGVRFPFDQPMKIYSSLWNADDWATRGGLEKTDWSKAPFVASYRSFHVDGCEASVNAKFCDTQGKRWWDQKEFQDLDSFQYRRLRWVRSKYTIYNYCTDRKRYPVMPPECKRDRDI |
| Enzyme Length | 295 |
| Uniprot Accession Number | G5DAC7 |
| Absorption | |
| Active Site | ACT_SITE 108; /note="Nucleophile"; /evidence="ECO:0000255|PIRSR:PIRSR005604-1, ECO:0000255|PROSITE-ProRule:PRU10064"; ACT_SITE 112; /note="Proton donor"; /evidence="ECO:0000255|PIRSR:PIRSR005604-1, ECO:0000255|PROSITE-ProRule:PRU10064" |
| Activity Regulation | |
| Binding Site | BINDING 112; /note=Xyloglucan; /evidence=ECO:0000250|UniProtKB:Q8GZD5; BINDING 206; /note=Xyloglucan; via carbonyl oxygen; /evidence=ECO:0000250|UniProtKB:Q8GZD5; BINDING 281; /note=Xyloglucan; /evidence=ECO:0000250|UniProtKB:Q8GZD5 |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Breaks a beta-(1->4) bond in the backbone of a xyloglucan and transfers the xyloglucanyl segment on to O-4 of the non-reducing terminal glucose residue of an acceptor, which can be a xyloglucan or an oligosaccharide of xyloglucan.; EC=2.4.1.207; Evidence={ECO:0000255|RuleBase:RU361120, ECO:0000269|PubMed:25849978}; |
| DNA Binding | |
| EC Number | 2.4.1.207 |
| Enzyme Function | FUNCTION: Catalyzes xyloglucan endotransglycosylation (XET). Cleaves and religates xyloglucan polymers. Does not catalyze xyloglucan endohydrolysis (XEH). Probably involved in cell wall restructuring during fruit ripening and postharvest fruit softening. {ECO:0000269|PubMed:25849978}. |
| Temperature Dependency | |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is between 4.5-6.5. Loses activity rapidly when pH is lowered from 5 to 4. {ECO:0000269|PubMed:25849978}; |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Binding site (3); Chain (1); Disulfide bond (2); Domain (1); Glycosylation (1); Region (3); Signal peptide (1); Site (1) |
| Keywords | Apoplast;Cell wall;Cell wall biogenesis/degradation;Disulfide bond;Fruit ripening;Glycoprotein;Glycosidase;Glycosyltransferase;Hydrolase;Secreted;Signal;Transferase |
| Interact With | |
| Induction | INDUCTION: In fruits, expression is greatly decreased by gibberellic acid (GA3) on day 12 of storage and by 1-methylcyclopropene (1-MCP) until day 12 of storage (PubMed:23265513). Expression in fruits is also decreased by low (0 degrees Celsius) temperature treatment throughout the storage (PubMed:25849978). {ECO:0000269|PubMed:23265513, ECO:0000269|PubMed:25849978}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted, cell wall {ECO:0000255|RuleBase:RU361120, ECO:0000269|PubMed:25849978}. Secreted, extracellular space, apoplast {ECO:0000255|RuleBase:RU361120}. |
| Modified Residue | |
| Post Translational Modification | PTM: Contains at least one intrachain disulfide bond essential for its enzymatic activity. {ECO:0000255|RuleBase:RU361120}. |
| Signal Peptide | SIGNAL 1..23; /evidence=ECO:0000255|RuleBase:RU361120 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 34,317 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 2.4.1.207; |