| IED ID | IndEnz0011000475 |
| Enzyme Type ID | glucanase000475 |
| Protein Name |
Xyloglucan endotransglucosylase/hydrolase protein 19 At-XTH19 XTH-19 EC 2.4.1.207 |
| Gene Name | XTH19 At4g30290 F17I23.370 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MKSFTFLILFLFAAQSISVYAGSFHKDVKIHWGDGRGKIHDNQGKLLSLSLDKSSGSGFQSNQEFLYGKAEVQMKLVPGNSAGTVTTFYLKSPGTTWDEIDFEFLGNISGHPYTLHTNVYTKGSGDKEQQFHLWFDPTANFHTYCITWNPQRIIFTVDGIPIREFMNAESRGVPFPTKQPMRLYASLWEAEHWATRGGLEKTDWSKAPFTAYYRNYNVEGCVWVNGKSVCPANSQWFTQKLDSNGQTRMKGVQSKYMVYNYCSDKKRFPRGVPPECS |
| Enzyme Length | 277 |
| Uniprot Accession Number | Q9M0D1 |
| Absorption | |
| Active Site | ACT_SITE 99; /note=Nucleophile; /evidence=ECO:0000255|PROSITE-ProRule:PRU10064; ACT_SITE 103; /note=Proton donor; /evidence=ECO:0000255|PROSITE-ProRule:PRU10064 |
| Activity Regulation | |
| Binding Site | BINDING 103; /note=Xyloglucan; /evidence=ECO:0000250|UniProtKB:Q8GZD5; BINDING 197; /note=Xyloglucan; via carbonyl oxygen; /evidence=ECO:0000250|UniProtKB:Q8GZD5; BINDING 267; /note=Xyloglucan; /evidence=ECO:0000250|UniProtKB:Q8GZD5 |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Breaks a beta-(1->4) bond in the backbone of a xyloglucan and transfers the xyloglucanyl segment on to O-4 of the non-reducing terminal glucose residue of an acceptor, which can be a xyloglucan or an oligosaccharide of xyloglucan.; EC=2.4.1.207; Evidence={ECO:0000269|PubMed:20732879}; |
| DNA Binding | |
| EC Number | 2.4.1.207 |
| Enzyme Function | FUNCTION: Possesses xyloglucan endotransglucosylase (XET) activity in vitro. Does not possess xyloglucan endohydrolysis (XEH) activity (PubMed:20732879). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues (PubMed:23585673). Involved in cell proliferation in the tissue reunion process of wounded inflorescence stems. Maybe a downstream target of NAC071 as a consequence of auxin action in wounded stems (PubMed:25182467). {ECO:0000269|PubMed:20732879, ECO:0000269|PubMed:25182467, ECO:0000305|PubMed:23585673}. |
| Temperature Dependency | |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 7.0. {ECO:0000269|PubMed:20732879}; |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Binding site (3); Chain (1); Disulfide bond (2); Domain (1); Glycosylation (1); Region (3); Sequence conflict (2); Signal peptide (1); Site (1) |
| Keywords | Apoplast;Cell wall;Cell wall biogenesis/degradation;Disulfide bond;Glycoprotein;Glycosidase;Hydrolase;Reference proteome;Secreted;Signal;Transferase |
| Interact With | |
| Induction | INDUCTION: By auxin. {ECO:0000269|PubMed:11673616}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted, cell wall {ECO:0000305}. Secreted, extracellular space, apoplast {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | PTM: Contains at least one intrachain disulfide bond essential for its enzymatic activity. {ECO:0000250}. |
| Signal Peptide | SIGNAL 1..21; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 15328536; 15659443; 15720654; 16477366; 16813576; 16920880; 17496105; 19269997; 20688978; 32656780; 33190295; |
| Motif | |
| Gene Encoded By | |
| Mass | 31,563 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 2.4.1.207; |