| IED ID | IndEnz0011000479 |
| Enzyme Type ID | glucanase000479 |
| Protein Name |
Xyloglucan endotransglucosylase protein 6 XET protein 6 EC 2.4.1.207 DkXTH6 Xyloglucan endotransglucosylase/hydrolase protein 6 XTH protein 6 |
| Gene Name | XTH6 |
| Organism | Diospyros kaki (Kaki persimmon) (Diospyros chinensis) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae asterids Ericales Ebenaceae Diospyros Diospyros kaki (Kaki persimmon) (Diospyros chinensis) |
| Enzyme Sequence | MASSLTLPMAMAFTLLALSFASAMGGSMNSSRFDELFQPSWAFDHFVYEGEVLKMKLDNYSGAGFSSKGKYLFGKVTVQIKLVEGDSAGTVTAFYMSSDGTNHNEFDFEFLGNTTGEPYLVQTNVYVNGVGNREQRLNLWFDPTKDFHSYSLLWNQRQVVFMVDETPIRVHSNLEHRGIPFPKDQPMGVYSSIWNADDWATQGGRIKTDWSHAPFVASYQGFAIDACECPAAVAATDNARRCSSSAEKQFWWDMPTLSELSLHQSHQLIWVRANHLVYDYCTDTARFPVTPAECEHHRH |
| Enzyme Length | 299 |
| Uniprot Accession Number | A0A067XRK9 |
| Absorption | |
| Active Site | ACT_SITE 105; /note=Nucleophile; /evidence=ECO:0000255|PIRSR:PIRSR005604-1; ACT_SITE 109; /note=Proton donor; /evidence=ECO:0000255|PIRSR:PIRSR005604-1 |
| Activity Regulation | |
| Binding Site | BINDING 109; /note=Xyloglucan; /evidence=ECO:0000250|UniProtKB:Q8GZD5; BINDING 203; /note=Xyloglucan; via carbonyl oxygen; /evidence=ECO:0000250|UniProtKB:Q8GZD5; BINDING 286; /note=Xyloglucan; /evidence=ECO:0000250|UniProtKB:Q8GZD5 |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Breaks a beta-(1->4) bond in the backbone of a xyloglucan and transfers the xyloglucanyl segment on to O-4 of the non-reducing terminal glucose residue of an acceptor, which can be a xyloglucan or an oligosaccharide of xyloglucan.; EC=2.4.1.207; Evidence={ECO:0000255|RuleBase:RU361120, ECO:0000269|PubMed:27242828}; |
| DNA Binding | |
| EC Number | 2.4.1.207 |
| Enzyme Function | FUNCTION: Catalyzes xyloglucan endotransglycosylation (XET). Cleaves and religates xyloglucan polymers. Does not catalyze xyloglucan endohydrolysis (XEH). Probably involved in cell wall restructuring during postharvest fruit softening. {ECO:0000269|PubMed:27242828}. |
| Temperature Dependency | |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is around 6. Highly active between pH range 4.5-6.5. {ECO:0000269|PubMed:27242828}; |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Binding site (3); Chain (1); Disulfide bond (2); Domain (1); Glycosylation (1); Region (3); Signal peptide (1); Site (1) |
| Keywords | Apoplast;Cell wall;Cell wall biogenesis/degradation;Disulfide bond;Fruit ripening;Glycoprotein;Glycosidase;Glycosyltransferase;Hydrolase;Secreted;Signal;Transferase |
| Interact With | |
| Induction | INDUCTION: In fruits, up-regulated by abscisic acid (ABA) or by propylene treatment, and down-regulated by gibberellic acid (GA3) or by cold treatment during storage. {ECO:0000269|PubMed:27242828}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted, cell wall {ECO:0000255|RuleBase:RU361120, ECO:0000269|PubMed:27242828}. Secreted, extracellular space, apoplast {ECO:0000255|RuleBase:RU361120}. |
| Modified Residue | |
| Post Translational Modification | PTM: Contains at least one intrachain disulfide bond essential for its enzymatic activity. {ECO:0000255|RuleBase:RU361120}. |
| Signal Peptide | SIGNAL 1..25; /evidence=ECO:0000255|RuleBase:RU361120 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 33,764 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 2.4.1.207;3.2.1.151; |