| IED ID | IndEnz0011000488 |
| Enzyme Type ID | glucanase000488 |
| Protein Name |
Xyloglucan endotransglucosylase/hydrolase protein 31 At-XTH31 AtXTR8 XTH-31 EC 2.4.1.207 EC 3.2.1.151 |
| Gene Name | XTH31 ATXG XTR8 At3g44990 F14D17.60 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MALSLIFLALLVLCPSSGHSQRSPSPGYYPSSRVPTSPFDREFRTLWGSQHQRREQDVVTLWLDKSTGSGFKSLRPYRSGYFGASIKLQPGFTAGVDTSLYLSNNQEHPGDHDEVDIEFLGTTPGKPYSLQTNVFVRGSGDRNVIGREMKFTLWFDPTQDFHHYAILWNPNQIVFFVDDVPIRTYNRKNEAIFPTRPMWVYGSIWDASDWATENGRIKADYRYQPFVAKYKNFKLAGCTADSSSSCRPPSPAPMRNRGLSRQQMAALTWAQRNFLVYNYCHDPKRDHTQTPEC |
| Enzyme Length | 293 |
| Uniprot Accession Number | P93046 |
| Absorption | |
| Active Site | ACT_SITE 114; /note=Nucleophile; /evidence=ECO:0000250|UniProtKB:Q8GZD5; ACT_SITE 118; /note=Proton donor; /evidence=ECO:0000250|UniProtKB:Q8GZD5 |
| Activity Regulation | |
| Binding Site | BINDING 118; /note=Xyloglucan; /evidence=ECO:0000250|UniProtKB:Q8GZD5; BINDING 285; /note=Xyloglucan; /evidence=ECO:0000250|UniProtKB:Q8GZD5 |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Breaks a beta-(1->4) bond in the backbone of a xyloglucan and transfers the xyloglucanyl segment on to O-4 of the non-reducing terminal glucose residue of an acceptor, which can be a xyloglucan or an oligosaccharide of xyloglucan.; EC=2.4.1.207; Evidence={ECO:0000269|PubMed:23104861}; CATALYTIC ACTIVITY: Reaction=Xyloglucan + H(2)O = xyloglucan oligosaccharides.; EC=3.2.1.151; Evidence={ECO:0000269|PubMed:23104861, ECO:0000269|PubMed:25446234}; |
| DNA Binding | |
| EC Number | 2.4.1.207; 3.2.1.151 |
| Enzyme Function | FUNCTION: Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues. Involved in the accumulation of hemicelluloses. Has a high XEH activity and only a slight XET activity in vitro, but the main in planta activity seems to be XET, thus controlling aluminum sensitivity (PubMed:23204407, PubMed:23104861, PubMed:25446234). Acceptor preferences are XXXGol = XXFGol > XXLGol > XLLGol = XLFGol (PubMed:25446234). {ECO:0000269|PubMed:23104861, ECO:0000269|PubMed:23204407, ECO:0000269|PubMed:25446234}. |
| Temperature Dependency | |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 5 for the XET activity. Optimum pH is 4.5 - 4.75 for the XEH activity. {ECO:0000269|PubMed:23104861, ECO:0000269|PubMed:25446234}; |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Binding site (2); Chain (1); Disulfide bond (2); Domain (1); Region (3); Sequence conflict (2); Signal peptide (1); Site (1) |
| Keywords | Apoplast;Cell membrane;Cell wall;Cell wall biogenesis/degradation;Disulfide bond;Glycosidase;Hydrolase;Membrane;Reference proteome;Secreted;Signal;Transferase |
| Interact With | |
| Induction | INDUCTION: Up-regulated by gibberellins (Probable). Not induced by auxin (Ref.1). Down-regulated by aluminum (PubMed:21285327, PubMed:23204407). {ECO:0000269|PubMed:21285327, ECO:0000269|PubMed:23204407, ECO:0000269|Ref.1, ECO:0000305}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted, cell wall {ECO:0000305}. Secreted, extracellular space, apoplast {ECO:0000305}. Cell membrane {ECO:0000269|PubMed:23204407}. |
| Modified Residue | |
| Post Translational Modification | PTM: Contains at least one intrachain disulfide bond essential for its enzymatic activity. {ECO:0000250}. |
| Signal Peptide | SIGNAL 1..20; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 12753585; 12805619; 12953064; 14576160; 15720654; 16412086; 16527868; 16648215; 17061125; 17142483; 17384169; 17497164; 18650403; 18796151; 19054359; 20007967; 22147073; 26578707; 28351986; |
| Motif | |
| Gene Encoded By | |
| Mass | 33,541 |
| Kinetics | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=86 uM for XXXGol {ECO:0000269|PubMed:25446234}; Note=KM for xyloglucan as donor substrate is 1.6 mg/ml. KM is quoted in mg/ml, not uM, because XTHs are able to utilise any segment of the polysaccharide chain equally well, not just one site per molecule as with the acceptor. {ECO:0000269|PubMed:25446234}; |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 2.4.1.207;3.2.1.151; |