| IED ID | IndEnz0011000491 |
| Enzyme Type ID | glucanase000491 |
| Protein Name |
Xyloglucan-specific endo-beta-1,4-glucanase A EC 3.2.1.151 Xyloglucanase A Xyloglucanendohydrolase A |
| Gene Name | xgeA |
| Organism | Aspergillus aculeatus |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta Eurotiomycetes Eurotiomycetidae Eurotiales (green and blue molds) Aspergillaceae Aspergillus Aspergillus subgen. Circumdati Aspergillus aculeatus |
| Enzyme Sequence | MKLSLLSLATLASAASLQRRSDFCGQWDTATAGDFTLYNDLWGESAGTGSQCTGVDSYSGDTIAWHTSWSWSGGSSSVKSYVNAALTFTPTQLNCISSIPTTWKWSYSGSSIVADVAYDTFLAETASGSSKYEIMVWLAALGGAGPISSTGSTIATPTIAGVNWKLYSGPNGDTTVYSFVADSTTESFSGDLNDFFTYLVDNEGVSDELYLTTLEAGTEPFTGSNAKLTVSEYSISIE |
| Enzyme Length | 238 |
| Uniprot Accession Number | O94218 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Xyloglucan + H(2)O = xyloglucan oligosaccharides.; EC=3.2.1.151; |
| DNA Binding | |
| EC Number | 3.2.1.151 |
| Enzyme Function | FUNCTION: Catalyzes endohydrolysis of 1,4-beta-D-glucosidic linkages in xyloglucan with retention of the beta-configuration of the glycosyl residues. Specific for xyloglucan and does not hydrolyze other cell wall components. {ECO:0000269|PubMed:15094064, ECO:0000269|PubMed:9884411}. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Optimum temperature is below 30 degrees Celsius. Is very stable below 35 degrees Celsius, but at 50 degrees Celsius, it loses 80 percent of its activity within 2 h. {ECO:0000269|PubMed:9884411}; |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 3.4. Stability declines sharply below pH 2.8 and above pH 5.0. {ECO:0000269|PubMed:9884411}; |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (14); Chain (1); Helix (3); Signal peptide (1) |
| Keywords | 3D-structure;Carbohydrate metabolism;Cell wall biogenesis/degradation;Glycosidase;Hydrolase;Polysaccharide degradation;Secreted;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..14; /evidence=ECO:0000255 |
| Structure 3D | X-ray crystallography (3) |
| Cross Reference PDB | 3VL8; 3VL9; 3VLB; |
| Mapped Pubmed ID | 22496365; |
| Motif | |
| Gene Encoded By | |
| Mass | 25,159 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 3.2.1.151; |