IED ID | IndEnz0011000497 |
Enzyme Type ID | glucanase000497 |
Protein Name |
Probable xyloglucan endotransglucosylase/hydrolase protein 10 At-XTH10 XTH-10 EC 2.4.1.207 |
Gene Name | XTH10 XTR14 At2g14620 T6B13.14 |
Organism | Arabidopsis thaliana (Mouse-ear cress) |
Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
Enzyme Sequence | MTLINRSKPFVLLVGFSIISSLLLWVSQASVVSSGDFNKDFFVTWSPTHVNTSNDGRSRTLKLDQESGASFSSIQTFLFGQIDMKIKLIRGSSQGTVVAYYMSSDQPNRDEIDFEFLGNVNGQPYILQTNVYAEGLDNREERIHLWFDPAKDFHTYSILWNIHQIVFMVDQIPIRLYRNHGEKGVAYPRLQPMSVQASLWNGESWATRGGHDKIDWSKGPFVASFGDYKIDACIWIGNTSFCNGESTENWWNKNEFSSLTRVQKRWFKWVRKYHLIYDYCQDYGRFNNKLPKECSLPKY |
Enzyme Length | 299 |
Uniprot Accession Number | Q9ZVK1 |
Absorption | |
Active Site | ACT_SITE 111; /note=Nucleophile; /evidence=ECO:0000250|UniProtKB:Q8GZD5; ACT_SITE 115; /note=Proton donor; /evidence=ECO:0000250|UniProtKB:Q8GZD5 |
Activity Regulation | |
Binding Site | BINDING 115; /note=Xyloglucan; /evidence=ECO:0000250|UniProtKB:Q8GZD5; BINDING 209; /note=Xyloglucan; via carbonyl oxygen; /evidence=ECO:0000250|UniProtKB:Q8GZD5; BINDING 285; /note=Xyloglucan; /evidence=ECO:0000250|UniProtKB:Q8GZD5 |
Calcium Binding | |
catalytic Activity | CATALYTIC ACTIVITY: Reaction=Breaks a beta-(1->4) bond in the backbone of a xyloglucan and transfers the xyloglucanyl segment on to O-4 of the non-reducing terminal glucose residue of an acceptor, which can be a xyloglucan or an oligosaccharide of xyloglucan.; EC=2.4.1.207; |
DNA Binding | |
EC Number | 2.4.1.207 |
Enzyme Function | FUNCTION: Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues (By similarity). {ECO:0000250}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Active site (2); Binding site (3); Chain (1); Disulfide bond (2); Domain (1); Glycosylation (2); Region (3); Signal peptide (1); Site (1) |
Keywords | Apoplast;Cell wall;Cell wall biogenesis/degradation;Disulfide bond;Glycoprotein;Glycosidase;Hydrolase;Reference proteome;Secreted;Signal;Transferase |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Secreted, cell wall {ECO:0000305}. Secreted, extracellular space, apoplast {ECO:0000305}. |
Modified Residue | |
Post Translational Modification | PTM: Contains at least one intrachain disulfide bond essential for its enzymatic activity. {ECO:0000250}. |
Signal Peptide | SIGNAL 1..29; /evidence=ECO:0000255 |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | 11673616; 12620105; 14576160; 15516340; 15720654; 15860015; 16824183; 17142483; 18650403; 31100875; |
Motif | |
Gene Encoded By | |
Mass | 34,687 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |