| IED ID | IndEnz0011000501 |
| Enzyme Type ID | glucanase000501 |
| Protein Name |
Xyloglucan endotransglycosylase/hydrolase protein 8 EC 2.4.1.207 End-xyloglucan transferase OsXRT5 OsXTH8 |
| Gene Name | XTH8 XRT5 Os08g0237000 LOC_Os08g13920 P0682A06.17 |
| Organism | Oryza sativa subsp. japonica (Rice) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae Liliopsida Petrosaviidae commelinids Poales Poaceae BOP clade Oryzoideae Oryzeae Oryzinae Oryza Oryza sativa (Rice) Oryza sativa subsp. japonica (Rice) |
| Enzyme Sequence | MAKHLALSVAAAVAVSWLAASSAAAAGFYEKFDVVGAGDHVRVVSDDGKTQQVALTLDRSSGSGFTSKDTYLFGEFSVQMKLVGGNSAGTVTSFYLSSGEGDGHDEIDIEFMGNLSGNPYVMNTNVWANGDGKKEHQFYLWFDPTADFHTYKIIWNPQNIIFQVDDVPVRTFKKYDDLAYPQSKPMRLHATLWDGSYWATRHGDVKIDWSGAPFVVSYRGYSTNACVNNNPAGGWSSSWCPEGTSAWIHRELDGAELGTVAWAERNYMSYNYCADGWRFPQGFPAECYRK |
| Enzyme Length | 290 |
| Uniprot Accession Number | Q76BW5 |
| Absorption | |
| Active Site | ACT_SITE 106; /note=Nucleophile; /evidence=ECO:0000255|PROSITE-ProRule:PRU10064; ACT_SITE 110; /note=Proton donor; /evidence=ECO:0000255|PROSITE-ProRule:PRU10064 |
| Activity Regulation | |
| Binding Site | BINDING 110; /note=Xyloglucan; /evidence=ECO:0000250|UniProtKB:Q8GZD5; BINDING 278; /note=Xyloglucan; /evidence=ECO:0000250|UniProtKB:Q8GZD5 |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Breaks a beta-(1->4) bond in the backbone of a xyloglucan and transfers the xyloglucanyl segment on to O-4 of the non-reducing terminal glucose residue of an acceptor, which can be a xyloglucan or an oligosaccharide of xyloglucan.; EC=2.4.1.207; |
| DNA Binding | |
| EC Number | 2.4.1.207 |
| Enzyme Function | FUNCTION: Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues (By similarity). May promote elongation of three internodes (II, III and IV) and may be involved in cell elongation processes. {ECO:0000250, ECO:0000269|PubMed:15516498}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Binding site (2); Chain (1); Disulfide bond (2); Domain (1); Glycosylation (1); Region (3); Sequence conflict (1); Signal peptide (1); Site (1) |
| Keywords | Apoplast;Cell wall;Cell wall biogenesis/degradation;Direct protein sequencing;Disulfide bond;Glycoprotein;Glycosidase;Hydrolase;Reference proteome;Secreted;Signal;Transferase |
| Interact With | |
| Induction | INDUCTION: By gibberellic acid (GA3). Accumulation continues to increase throughout 24 hours of GA3 treatment. Very little effect by other plant hormones like brassinolide (BL), 6-benzyladenine (BA), indole-3-acetic acid (IAA), and abscisic acid (ABA). Inhibitory effect from uniconazole, a potent GA biosynthesis inhibitor. {ECO:0000269|PubMed:15516498}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted, cell wall {ECO:0000305}. Secreted, extracellular space, apoplast {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | PTM: Contains at least one intrachain disulfide bond essential for its enzymatic activity. {ECO:0000250}. |
| Signal Peptide | SIGNAL 1..25; /evidence=ECO:0000269|PubMed:16758443 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 24597823; |
| Motif | |
| Gene Encoded By | |
| Mass | 32,097 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 2.4.1.207; |