| IED ID | IndEnz0014000002 |
| Enzyme Type ID | pancreatin000002 |
| Protein Name |
Gamma conglutin 1 Conglutin gamma 32 allergen Lup a gamma-conglutin Cleaved into: Gamma conglutin 1 beta subunit Gamma conglutin 1 17 kDa subunit Gamma conglutin 1 small subunit ; Gamma conglutin 1 alpha subunit Gamma conglutin 1 29 kDa subunit Gamma conglutin 1 large subunit |
| Gene Name | Cgamma |
| Organism | Lupinus albus (White lupine) (Lupinus termis) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade genistoids sensu lato core genistoids Genisteae Lupinus Lupinus albus (White lupine) (Lupinus termis) |
| Enzyme Sequence | MAKNMAPILHILVISLSYSFLFVTSSSQNSQSLYHNSQPTSSSKPNLLVLPIQQDASTKLHWGNILKRTPLMQVPVLLDLNGKHLWVTCSQHYSSSTYQAPFCHSTQCSRANTHQCFTCTDSTTSRPGCHNNTCGLISSNPVTQESGLGELAQDVLALHSTHGSKLGSLVKIPQFLFSCAPTFLTQKGLPNNVQGALGLGHAPISLPNQLFSHFGLKRQFTMCLSSYPTSNGAILFGDINDPNNNNYIHNSLDVLHDMVYTPLTISKQGEYFIQVSAIRVNKHMVIPTKNPSMFPSSSSSSYHESSEIGGAMITTTNPYTVLRHSIFEVFTQVFANNVPKQAQVKAVGPFGLCYDTKKISGGVPSVDLIMDKSDVVWRISGENLMVQAQDGVSCLGFVDGGVHTRAGIALGTHQLEENLVVFDLARSRVGFNTNSLKSHGKSCSNLFDLNNP |
| Enzyme Length | 452 |
| Uniprot Accession Number | Q9FSH9 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Sulfur-rich seed storage protein that remains undegraded at germination (PubMed:11406286). The uncleaved form exhibits some inhibitory activity against GH11 xylanase from T.longibrachiatum, more at pH 7 than at pH 5.3, but not against GH12 xyloglucan-specific endoglucanase (XEG) from A.aculeatus (PubMed:26741537). Binds to model phospholipid membranes containing dimyristoyl phosphatidylglycerol (DMPG), dioleoyl phosphatidic acid (DOPA) or mixture of dimyristoyl phosphatidylcholine and dimyristoyl phosphatidylglycerol (DMPC:DMPG), or mixture of dioleoyl phosphatidic acid and dioleoyl phosphatidylcholine (DOPC:DOPA) (PubMed:30312772). {ECO:0000269|PubMed:26741537, ECO:0000269|PubMed:30312772, ECO:0000303|PubMed:11406286}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (3); Disulfide bond (7); Domain (1); Glycosylation (1); Mutagenesis (3); Signal peptide (1); Site (4) |
| Keywords | Allergen;Direct protein sequencing;Disulfide bond;Glycoprotein;Secreted;Signal |
| Interact With | |
| Induction | INDUCTION: Secreted in high amounts upon heat treatment of mature seeds (PubMed:11406286). Strongly induced by chitosan in the cotyledons of germinating seeds (PubMed:19962718). {ECO:0000269|PubMed:19962718, ECO:0000303|PubMed:11406286}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted, extracellular space {ECO:0000303|PubMed:11406286}. Note=Present in the extracellular spaces of germinating cotyledons and in the young roots. {ECO:0000303|PubMed:11406286}. |
| Modified Residue | |
| Post Translational Modification | PTM: Glycosylated on alpha chain at Asn-131; identified N-glycans bound are Man(2)(Xyl)(Fuc)GlcNAc(2), Man(3)(Xyl)(Fuc)GlcNAc(2), GlcNAcMan(3)(Xyl)(Fuc)GlcNAc(2) and GlcNAc(2)Man(3)(Xyl)(Fuc)GlcNAc(2). {ECO:0000269|PubMed:24069245}. |
| Signal Peptide | SIGNAL 1..33; /evidence=ECO:0000269|PubMed:11406286 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 49,219 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |