| IED ID | IndEnz0015000017 |
| Enzyme Type ID | laccase000017 |
| Protein Name |
Laccase-2 EC 1.10.3.2 FpLCC2 |
| Gene Name | LCC2 FOMPIDRAFT_51906 |
| Organism | Fomitopsis pinicola (strain FP-58527) (Brown rot fungus) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Basidiomycota Agaricomycotina Agaricomycetes Agaricomycetes incertae sedis Polyporales Fomitopsidaceae Fomitopsis Fomitopsis pinicola Fomitopsis pinicola (strain FP-58527) (Brown rot fungus) |
| Enzyme Sequence | MLLSSAFVGSCLAILNFAAAVSAQGGLSRTTLNIVNKVISPDGYSRDSVLANGIHPGPLISGNKGDTFQINVNNQLHDNSMNTSTTVHWHGIDQHHTNWADGPAFVTQCPIVPEHSFLYNFTVPDQAGTFWYHSHESVQYCDGLRGPLVVYDPEDPHKDLYDVDDDTTIISLSDWYHSPAHELLPGPIPPNSTLINSLGRPDGSDLPVTIIEVDPTKRYRFRLISMACHPYFDFSIDGHNMTIIEADGSNTEPLSDIDQIRIYPAQRYSFVLEPNQTPGDYWIRAAPLQLGNTSNPDTTTSLGLAILRYTNRSGYAQAASVDPYDISQTPIPVNPLLEQNLHAYGDVPELDEECDDCKLTFDFAFNFTAVDFTVNGTSYVNPTVPVLLQILNGTYTAQELLPHHSVYTLPRNKTIEITMPGAVTGGPHPMHLHGHSFYVIQSMGSDTTNTVNPVLRDTVAVGGATGDNVVIRFRTDNPGPWIMHCHIDFHLALGFAVVLAEAPQDVAEYVSPIPTWDELCPIWDNAPSHN |
| Enzyme Length | 530 |
| Uniprot Accession Number | S8FGV1 |
| Absorption | |
| Active Site | |
| Activity Regulation | ACTIVITY REGULATION: Inhibited by chloride ions (PubMed:34116754). Inhibited by citrate (PubMed:34116754). Inhibited by oxalate (PubMed:34116754). Activated by acetate (PubMed:34116754). {ECO:0000269|PubMed:34116754}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=4 hydroquinone + O2 = 4 benzosemiquinone + 2 H2O; Xref=Rhea:RHEA:11276, ChEBI:CHEBI:15377, ChEBI:CHEBI:15379, ChEBI:CHEBI:17594, ChEBI:CHEBI:17977; EC=1.10.3.2; Evidence={ECO:0000269|PubMed:34116754}; |
| DNA Binding | |
| EC Number | 1.10.3.2 |
| Enzyme Function | FUNCTION: In vitro, has activity towards 2,2'-azino-bis(3-ethylbenzthiazoline-6-sulfonic acid) (ABTS), 2,6-dimethoxy-phenol, and guaiacol (PubMed:34116754). Although brown rot fungi preferentially degrade hemicellulose and cellulose, the enzyme may contribute to generating small amounts of lignin breakdown products required for catalytic reactions (PubMed:34116754). {ECO:0000269|PubMed:34116754, ECO:0000303|PubMed:34116754}. |
| Temperature Dependency | |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 2.5 or below with 2,2'-azino-bis(3-ethylbenzthiazoline-6-sulfonic acid) (ABTS) or 2,6-dimethoxy-phenol as substrate, and 3.5 with guaiacol as substrate.; |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (2); Domain (3); Glycosylation (10); Metal binding (11); Signal peptide (1) |
| Keywords | Copper;Disulfide bond;Glycoprotein;Metal-binding;Oxidoreductase;Reference proteome;Repeat;Secreted;Signal |
| Interact With | |
| Induction | INDUCTION: Expressed during growth on spruce wood (at protein level). {ECO:0000269|PubMed:34116754}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:34116754}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..23; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 58,324 |
| Kinetics | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=20.1 uM for 2,2'-azino-bis(3-ethylbenzthiazoline-6-sulfonic acid) (ABTS) (at pH 3.0 and 30 degrees Celsius) {ECO:0000269|PubMed:34116754}; KM=22.4 uM for 2,2'-azino-bis(3-ethylbenzthiazoline-6-sulfonic acid) (ABTS) (at pH 5.0 and 30 degrees Celsius) {ECO:0000269|PubMed:34116754}; KM=64.4 uM for 2,6-dimethoxy-phenol (at pH 3.0 and 30 degrees Celsius) {ECO:0000269|PubMed:34116754}; KM=8.0 uM for 2,6-dimethoxy-phenol (at pH 5.0 and 30 degrees Celsius) {ECO:0000269|PubMed:34116754}; KM=1790.0 uM for guaiacol (at pH 3.0 and 30 degrees Celsius) {ECO:0000269|PubMed:34116754}; KM=918 uM for guaiacol (at pH 5.0 and 30 degrees Celsius) {ECO:0000269|PubMed:34116754}; Note=kcat is 315 sec(-1) with 2,2'-azino-bis(3-ethylbenzthiazoline-6-sulfonic acid) (ABTS) as substrate (at pH 3.0 and 30 degrees Celsius). kcat is 42.6 sec(-1) with 2,2'-azino-bis(3-ethylbenzthiazoline-6-sulfonic acid) (ABTS) as substrate (at pH 5.0 and 30 degrees Celsius). kcat is 155 sec(-1) with 2,6-dimethoxy-phenol as substrate (at pH 3.0 and 30 degrees Celsius). kcat is 14.8 sec(-1) with 2,6-dimethoxy-phenol as substrate (at pH 5.0 and 30 degrees Celsius). cat is 48 sec(-1) with guaiacol as substrate (at pH 3.0 and 30 degrees Celsius). kcat is 16.7 sec(-1) with guaiacol as substrate (at pH 5.0 and 30 degrees Celsius).; |
| Metal Binding | METAL 88; /note=Copper 1; type 2; /evidence=ECO:0000250|UniProtKB:D0VWU3; METAL 90; /note=Copper 2; type 3; /evidence=ECO:0000250|UniProtKB:D0VWU3; METAL 133; /note=Copper 2; type 3; /evidence=ECO:0000250|UniProtKB:D0VWU3; METAL 135; /note=Copper 3; type 3; /evidence=ECO:0000250|UniProtKB:D0VWU3; METAL 428; /note=Copper 4; type 1; /evidence=ECO:0000250|UniProtKB:D0VWU3; METAL 431; /note=Copper 1; type 2; /evidence=ECO:0000250|UniProtKB:D0VWU3; METAL 433; /note=Copper 3; type 3; /evidence=ECO:0000250|UniProtKB:D0VWU3; METAL 484; /note=Copper 3; type 3; /evidence=ECO:0000250|UniProtKB:D0VWU3; METAL 485; /note=Copper 4; type 1; /evidence=ECO:0000250|UniProtKB:D0VWU3; METAL 486; /note=Copper 2; type 3; /evidence=ECO:0000250|UniProtKB:D0VWU3; METAL 490; /note=Copper 4; type 1; /evidence=ECO:0000250|UniProtKB:D0VWU3 |
| Rhea ID | RHEA:11276 |
| Cross Reference Brenda |