| IED ID | IndEnz0015000018 |
| Enzyme Type ID | laccase000018 |
| Protein Name |
Laccase-2d EC 1.10.3.2 Benzenediol:oxygen oxidoreductase Diphenol oxidase Laccase-IId Lac-IId Urishiol oxidase Fragments |
| Gene Name | |
| Organism | Cerrena unicolor (Canker rot fungus) (Daedalea unicolor) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Basidiomycota Agaricomycotina Agaricomycetes Agaricomycetes incertae sedis Polyporales Cerrenaceae Cerrena Cerrena unicolor (Canker rot fungus) (Daedalea unicolor) |
| Enzyme Sequence | GTGPVADLHIINKDLSPDGFQRPTVVAGGGRDVVSIGRAGDNVTIRF |
| Enzyme Length | 47 |
| Uniprot Accession Number | P85430 |
| Absorption | |
| Active Site | |
| Activity Regulation | ACTIVITY REGULATION: Inhibited by sodium azide, SDS and mercaptoethanol, but not by 4-hexyl resocinol, L-cysteine and dithiothreitol. Activity is inhibited by the heavy metal ions Cr, W, Sn, Ag(+) and Hg(2+), but not by Pb(2+), Fe(3+), Ni(2+), Li(2+), Co(2+) or Cd(2+). {ECO:0000269|PubMed:19283431}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=4 hydroquinone + O2 = 4 benzosemiquinone + 2 H2O; Xref=Rhea:RHEA:11276, ChEBI:CHEBI:15377, ChEBI:CHEBI:15379, ChEBI:CHEBI:17594, ChEBI:CHEBI:17977; EC=1.10.3.2; Evidence={ECO:0000269|PubMed:19283431}; |
| DNA Binding | |
| EC Number | 1.10.3.2 |
| Enzyme Function | FUNCTION: Lignin degradation and detoxification of lignin-derived products (By similarity). Has highest activity towards ABTS, also active towards ferulic acid and guaiacol, but is not active towards tyrosine, vanillic acid, 2,5-dimethyl aniline, p-anisidine or violuric acid (PubMed:19283431). {ECO:0000250|UniProtKB:Q70KY3, ECO:0000269|PubMed:19283431}. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Optimum temperature is 70 degrees Celsius at pH 3.0 with ABTS as substrate. Retains 100% of its activity after 1 hour at 30 degrees Celsius at pH 9.0. Retains more than 60% of its activity after 180 minutes at 60 degrees Celsius at pH 9.0. Retains approximately 50% of its activity after 90 minutes at 70 degrees Celsius at pH 9.0. {ECO:0000269|PubMed:19283431}; |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 3.0 at 70 degrees Celsius with ABTS as substrate, and 6.0 with guaiacol and syringaldazine as substrate. {ECO:0000269|PubMed:19283431}; |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Domain (1); Non-adjacent residues (1); Non-terminal residue (1) |
| Keywords | Copper;Direct protein sequencing;Glycoprotein;Lignin degradation;Metal-binding;Oxidoreductase;Repeat;Secreted |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | PTM: N-glycosylated; contains 17% carbohydrates. {ECO:0000269|PubMed:19283431}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 4,846 |
| Kinetics | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=54.1 uM for ABTS (at 70 degrees Celsius) {ECO:0000269|PubMed:19283431}; KM=57.1 uM for ABTS (at 30 degrees Celsius) {ECO:0000269|PubMed:19283431}; KM=19.2 uM for syringaldizine (at 30 degrees Celsius) {ECO:0000269|PubMed:19283431}; |
| Metal Binding | |
| Rhea ID | RHEA:11276 |
| Cross Reference Brenda |