| IED ID | IndEnz0015000032 |
| Enzyme Type ID | laccase000032 |
| Protein Name |
Dirigent protein 5 AtDIR5 |
| Gene Name | DIR5 At1g64160 F22C12.8 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MVGQMKSFLFLFVFLVLTKTVISARKPSKSQPKPCKNFVLYYHDIMFGVDDVQNATSAAVTNPPGLGNFKFGKLVIFDDPMTIDKNFQSEPVARAQGFYFYDMKNDYNAWFAYTLVFNSTQHKGTLNIMGADLMMVQSRDLSVVGGTGDFFMSRGIVTFETDTFEGAKYFRVKMDIKLYECY |
| Enzyme Length | 182 |
| Uniprot Accession Number | Q9SH66 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Dirigent proteins impart stereoselectivity on the phenoxy radical-coupling reaction, yielding optically active lignans from two molecules of coniferyl alcohol in the biosynthesis of lignans, flavonolignans, and alkaloids and thus plays a central role in plant secondary metabolism. Enantiocomplementary dirigent protein that mediates the laccase-catalyzed enantioselective oxidative phenol coupling of (E)-coniferyl alcohol to (-)-pinoresinol. {ECO:0000269|PubMed:22854967}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (1); Glycosylation (2); Signal peptide (1) |
| Keywords | Apoplast;Disulfide bond;Glycoprotein;Reference proteome;Secreted;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted, extracellular space, apoplast {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..23; /evidence=ECO:0000250 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 16998091; 17061125; 19946920; 28472349; |
| Motif | |
| Gene Encoded By | |
| Mass | 20,726 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |