| IED ID | IndEnz0015000114 |
| Enzyme Type ID | laccase000114 |
| Protein Name |
Dirigent protein 6 AtDIR6 |
| Gene Name | DIR6 At4g23690 F9D16.160 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MAFLVEKQLFKALFSFFLLVLLFSDTVLSFRKTIDQKKPCKHFSFYFHDILYDGDNVANATSAAIVSPPGLGNFKFGKFVIFDGPITMDKNYLSKPVARAQGFYFYDMKMDFNSWFSYTLVFNSTEHKGTLNIMGADLMMEPTRDLSVVGGTGDFFMARGIATFVTDLFQGAKYFRVKMDIKLYECY |
| Enzyme Length | 187 |
| Uniprot Accession Number | Q9SUQ8 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Dirigent proteins impart stereoselectivity on the phenoxy radical-coupling reaction, yielding optically active lignans from two molecules of coniferyl alcohol in the biosynthesis of lignans, flavonolignans, and alkaloids and thus plays a central role in plant secondary metabolism. Enantiocomplementary dirigent protein that mediates the laccase-catalyzed enantioselective oxidative phenol coupling of (E)-coniferyl alcohol to (-)-pinoresinol. {ECO:0000269|PubMed:19946920, ECO:0000269|PubMed:22854967}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (11); Chain (1); Disulfide bond (1); Glycosylation (2); Signal peptide (1); Turn (3) |
| Keywords | 3D-structure;Apoplast;Disulfide bond;Glycoprotein;Reference proteome;Secreted;Signal |
| Interact With | Itself |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted, extracellular space, apoplast {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..29; /evidence=ECO:0000269|PubMed:19946920 |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 5LAL; |
| Mapped Pubmed ID | 12753585; 15047898; 15531708; 15894741; 16920880; 23188459; 27756822; 28472349; 33112043; |
| Motif | |
| Gene Encoded By | |
| Mass | 21,412 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |