| IED ID | IndEnz0015000115 |
| Enzyme Type ID | laccase000115 |
| Protein Name |
Conidial pigment biosynthesis dehydratase EthD EC 1.-.-.- |
| Gene Name | EthD MAA_07746 |
| Organism | Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) (Metarhizium anisopliae (strain ARSEF 23)) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta sordariomyceta Sordariomycetes Hypocreomycetidae Hypocreales Clavicipitaceae Metarhizium Metarhizium robertsii Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) (Metarhizium anisopliae (strain ARSEF 23)) |
| Enzyme Sequence | MAISDSVSPEPQQLLCLTITAFRKPGMSEAAYREYMTKTHAPLVSGLMEEYGIVRYNMTHNNSKSRPLLFQLYDPEFSKLSDYDCIVQFVFRRMEDFLRMKSDPRFLEKVAPDHQKFADTSRSTMTIGYFEEFLENGKVVPK |
| Enzyme Length | 142 |
| Uniprot Accession Number | E9F647 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 1.-.-.- |
| Enzyme Function | FUNCTION: Dehydratase; part of the Pks1 gene cluster that mediates the biosynthesis of an anthraquinone derivative pigment that contributes to conidial pigmentation that provides protection from UV radiation, heat and cold stress (PubMed:28447400). The polyketide synthase Pks1 produces 1-acetyl-2,4,6,8-tetrahydroxy-9,10-anthraquinone though condensation of acetyl-CoA with malonyl-CoA (Probable). The dehydratase EthD and the laccase Mlac1 further convert the anthraquinone derivative into the final conidial pigment (Probable). {ECO:0000269|PubMed:28447400, ECO:0000305|PubMed:29958281}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | PATHWAY: Pigment biosynthesis. {ECO:0000269|PubMed:28447400}. |
| nucleotide Binding | |
| Features | Chain (1); Domain (1) |
| Keywords | Monooxygenase;Oxidoreductase |
| Interact With | |
| Induction | INDUCTION: Highly expressed during conidiation (PubMed:28447400). A conserved conidiation regulatory pathway containing BrlA, AbaA and WetA regulates expression. During conidiation BlrA up-regulates AbaA, which in turn controls WetA. Moreover, the Hog1 MAPK regulates fungal conidiation by controlling the conidiation regulatory pathway, and that all three pigmentation genes Pks1, EthD and Mlac1 exercise feedback regulation of conidiation (PubMed:28447400). {ECO:0000269|PubMed:28447400}. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 16,524 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |