| IED ID | IndEnz0015000132 |
| Enzyme Type ID | laccase000132 |
| Protein Name |
Proline iminopeptidase PfmaB PIP EC 3.4.11.5 Conidial pigment biosynthesis cluster protein B |
| Gene Name | PfmaB PFICI_07098 |
| Organism | Pestalotiopsis fici (strain W106-1 / CGMCC3.15140) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta sordariomyceta Sordariomycetes Xylariomycetidae Xylariales Sporocadaceae Pestalotiopsis Pestalotiopsis fici Pestalotiopsis fici (strain W106-1 / CGMCC3.15140) |
| Enzyme Sequence | MVEFVEINGAQLAYRICGPEDAPLVITLHGGRGMGNHQSDFKAFSPLGDSYRILSFDYRGHGQSSRTKPYTFEQIVDDIDGMRARFAGPEKQVIILGGSFGGFLAQQYAIKYASHVSHLILRGTAPSHHHEEGAIKTLEQRLSKVPSFSIEMLKDKVFGAFDSDLEFRMVHLVMSPLYSESFDANAALQSCLNNVYNAESHNDLYSEKEKYFDYTKDLHRITAKTLVVVGDKDWICPPENSKFIAKEIKDAELFLVENANHSVHVEKNDLVVKKIRSHLEK |
| Enzyme Length | 281 |
| Uniprot Accession Number | W3XA95 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Release of N-terminal proline from a peptide.; EC=3.4.11.5; Evidence={ECO:0000305|PubMed:28517364}; |
| DNA Binding | |
| EC Number | 3.4.11.5 |
| Enzyme Function | FUNCTION: Proline iminopeptidase; part of the gene cluster that mediates the biosynthesis of dihydroxynaphthalene (DHN)-melanin, a bluish-green pigment forming a dark layer in the conidial wall that protects the conidia from UV radiations (PubMed:28517364). The first step of the pathway is the production of the pentaketide 1,3,6,8-tetrahydroxynaphthalene (1,3,6,8-THN or T4HN) by the polyketide synthase PfmaE though condensation of acetyl-CoA with malonyl-CoA. T4HN is not stable and easily oxidizes into the stable form flaviolin (PubMed:28517364). T4HN is also substrate of the hydroxynaphthalene reductase PfmaG to yield scytalone (PubMed:28517364). The scytalone dehydratase PfmaJ then reduces scytalone to 1,3,8-THN (PubMed:31116900). 1,3,8-THN is then substrate of the hydroxynaphthalene reductase PfmaI to yield vermelone (Probable). Vermelone is further converted by the multicopper oxidase PfmaD to 1,8-DHN (Probable). Finally the laccase PFICI_06862 transforms 1,8-DHN to DHN-melanin (Probable). The roles of the 5-oxoprolinase PfmaA and the proline iminopeptidase PfmaB within the cluster have not been elucidated yet (Probable). {ECO:0000269|PubMed:28517364, ECO:0000269|PubMed:31116900, ECO:0000305|PubMed:28517364, ECO:0000305|PubMed:31116900}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Domain (1) |
| Keywords | Aminopeptidase;Hydrolase;Melanin biosynthesis;Protease;Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 31,682 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |