| IED ID | IndEnz0015000151 |
| Enzyme Type ID | laccase000151 |
| Protein Name |
Probable O-methyltransferase ustE EC 2.1.1.- Ustilaginoidins biosynthesis cluster protein E |
| Gene Name | ustE UVI_02036190 |
| Organism | Ustilaginoidea virens (Rice false smut fungus) (Villosiclava virens) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta sordariomyceta Sordariomycetes Hypocreomycetidae Hypocreales Clavicipitaceae Ustilaginoidea Ustilaginoidea virens (Rice false smut fungus) (Villosiclava virens) |
| Enzyme Sequence | MADAKAVAKAELKSKDFVPRGNKSSSPLNTTLYLGLRALDCYIQYLILSRATGSFIIKFFGGSIIPHGPPVEAGFMHIEKLGLSGYRLLLLFMDILAAAKHFWFVLTVAEEAWTLTGAIVVGLDNIFFDTLNNLLFLCAATSAASSKAGGETLANPYLATGFIIFAVGLVTECVCEIDRKVFKKNPMNKGKPYTGGLFSLVRHPNYTAFTIWRSGLALASGGMIYGMSIAMFFMWDFSNRAVPALDEYCTKRVSYGPRDSTSTNWSRIWLLMTSSLVRRYVGRV |
| Enzyme Length | 284 |
| Uniprot Accession Number | A0A1B5L6A5 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 2.1.1.- |
| Enzyme Function | FUNCTION: Probable O-methyltransferase; part of the gene cluster that mediates the biosynthesis of ustilaginoidins, dimeric gamma-naphthopyrones isolated from different fungal species (PubMed:31050129). The first step in the biosynthesis of ustilaginoidins is the production of gamma-naphthopyrone precursor YWA1 by the non-reducing polyketide synthase ustP, via condensation of one acetyl-CoA starter unit with 6 malonyl-CoA units (PubMed:31050129). YWA1 is then probably substrate of the ustZ to yield norrubrofusarin via a dehydration reaction (Probable). A key enzyme in the biosynthetic pathway is the laccase ustL, which catalyzes the oxidative dimerization of norrubrofusarin to ustilaginoidin A (PubMed:31050129). It can produce the M- and P-atropisomers in varying amounts, depending on the reaction conditions (PubMed:31050129). For the biosynthesis of 3-methylustilaginoid in derivatives such as chaetochromin A, a methylated derivative of YWA1 is required (Probable). The C-methylation is considered to be catalyzed by ustM, the phosphopantetheine attachment site of which indicates that it acts on the growing polyketide chain before release of the product (Probable). For the biosynthesis of chaetochromin A, it is assumed that saturation of the D2 double bond takes place before dimerization, and is probably catalyzed by an external reductase because no candidate gene was identified within the cluster (Probable). {ECO:0000269|PubMed:31050129, ECO:0000305|PubMed:31050129}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | PATHWAY: Secondary metabolite biosynthesis. {ECO:0000305|PubMed:31050129}. |
| nucleotide Binding | |
| Features | Chain (1); Glycosylation (4); Transmembrane (3) |
| Keywords | Glycoprotein;Membrane;Methyltransferase;S-adenosyl-L-methionine;Transferase;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Membrane {ECO:0000255}; Multi-pass membrane protein {ECO:0000255}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 31,284 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |