| IED ID | IndEnz0015000154 |
| Enzyme Type ID | laccase000154 |
| Protein Name |
Scytalone dehydratase PfmaJ EC 4.2.1.94 Conidial pigment biosynthesis protein J |
| Gene Name | Pfmaj PFICI_02498 |
| Organism | Pestalotiopsis fici (strain W106-1 / CGMCC3.15140) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta sordariomyceta Sordariomycetes Xylariomycetidae Xylariales Sporocadaceae Pestalotiopsis Pestalotiopsis fici Pestalotiopsis fici (strain W106-1 / CGMCC3.15140) |
| Enzyme Sequence | MVNGNITFDDYLGLQQCLVEWADSYDSKDWSRLRKCIAPTLRIDYRSFLDKLWEAMPAEEFIAMISDKAVLGDPLLMTQHFIGGTKWEKISDTEVVGVHQLRVPHQRYTDETRSTVAVKGHAHSTNTHWYRKVNGEWKFAGLCPEIRWGEFDFDKVFASGREAFGTEDTAAEGISAKHQQQQHGRVTVSAV |
| Enzyme Length | 191 |
| Uniprot Accession Number | W3XEE6 |
| Absorption | |
| Active Site | ACT_SITE 80; /evidence=ECO:0000250|UniProtKB:P56221; ACT_SITE 105; /evidence=ECO:0000250|UniProtKB:P56221 |
| Activity Regulation | |
| Binding Site | BINDING 25; /note=Substrate; /evidence=ECO:0000250|UniProtKB:P56221; BINDING 45; /note=Substrate; /evidence=ECO:0000250|UniProtKB:P56221; BINDING 48; /note=Substrate; via carbonyl oxygen; /evidence=ECO:0000250|UniProtKB:P56221; BINDING 126; /note=Substrate; /evidence=ECO:0000250|UniProtKB:P56221 |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=scytalone = 1,3,8-trihydroxynaphthalene + H2O; Xref=Rhea:RHEA:24396, ChEBI:CHEBI:15377, ChEBI:CHEBI:16945, ChEBI:CHEBI:18393; EC=4.2.1.94; Evidence={ECO:0000269|PubMed:31116900}; |
| DNA Binding | |
| EC Number | 4.2.1.94 |
| Enzyme Function | FUNCTION: Scytalone dehydratase involved the biosynthesis of dihydroxynaphthalene (DHN)-melanin, a bluish-green pigment forming a dark layer in the conidial wall that protects the conidia from UV radiations (PubMed:28517364). The first step of the pathway is the production of the pentaketide 1,3,6,8-tetrahydroxynaphthalene (1,3,6,8-THN or T4HN) by the polyketide synthase PfmaE though condensation of acetyl-CoA with malonyl-CoA. T4HN is not stable and easily oxidizes into the stable form flaviolin (PubMed:28517364). T4HN is also substrate of the hydroxynaphthalene reductase PfmaG to yield scytalone (PubMed:28517364). The scytalone dehydratase PfmaJ then reduces scytalone to 1,3,8-THN (PubMed:31116900). 1,3,8-THN is then substrate of the hydroxynaphthalene reductase PfmaI to yield vermelone (Probable). Vermelone is further converted by the multicopper oxidase PfmaD to 1,8-DHN (Probable). Finally the laccase PFICI_06862 transforms 1,8-DHN to DHN-melanin (Probable). The roles of the 5-oxoprolinase PfmaA and the proline iminopeptidase PfmaB within the cluster have not been elucidated yet (Probable). {ECO:0000269|PubMed:28517364, ECO:0000269|PubMed:31116900, ECO:0000305|PubMed:28517364, ECO:0000305|PubMed:31116900}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | PATHWAY: Pigment biosynthesis; melanin biosynthesis. {ECO:0000269|PubMed:31116900}. |
| nucleotide Binding | |
| Features | Active site (2); Binding site (4); Chain (1) |
| Keywords | Endosome;Lyase;Melanin biosynthesis;Reference proteome |
| Interact With | |
| Induction | INDUCTION: Expression is positively regulazed by the cluster-specific transcription factor pfmaF. {ECO:0000269|PubMed:31116900}. |
| Subcellular Location | SUBCELLULAR LOCATION: Endosome {ECO:0000250|UniProtKB:P56221}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 21,808 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:24396 |
| Cross Reference Brenda |