| IED ID | IndEnz0016000046 |
| Enzyme Type ID | tyrosinase000046 |
| Protein Name |
Hemocyanin alpha chain Fragment |
| Gene Name | |
| Organism | Tachypleus tridentatus (Japanese horseshoe crab) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Chelicerata Merostomata (horseshoe crabs) Xiphosura Limulidae Tachypleus Tachypleus tridentatus (Japanese horseshoe crab) |
| Enzyme Sequence | TIKEKQASILALFEHLTSVPKQHIPEKERDNRLHDVGHLSRGKLFSLFHREHLEEATHLYEILHAAKNFDDFLLLCKQARDFVNEGM |
| Enzyme Length | 87 |
| Uniprot Accession Number | P02243 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Hemocyanins are copper-containing oxygen carriers occurring freely dissolved in the hemolymph of many mollusks and arthropods. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Non-terminal residue (1) |
| Keywords | Copper;Direct protein sequencing;Oxygen transport;Secreted;Transport |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted, extracellular space. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 10,203 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |