| IED ID | IndEnz0016000088 |
| Enzyme Type ID | tyrosinase000088 |
| Protein Name |
Melanocyte-stimulating hormone receptor MSH-R Melanocortin receptor 1 MC1-R |
| Gene Name | MC1R |
| Organism | Gorilla gorilla gorilla (Western lowland gorilla) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Gorilla Gorilla gorilla (western gorilla) Gorilla gorilla gorilla (Western lowland gorilla) |
| Enzyme Sequence | MAVQGSQRRLLGSLNSTPTAIPQLGLAANQTGARCLEVSIPDGLFLSLGLVSLVENVLVVATIAKNRNLHSPMYCFICCLALSDLLVSGSNVVDTLLLLLEAGALAARAAVLQQLDNVIDVITCSSMLSSLCFLGAIAVDRYISIFYALRYRSIVTLPRARRAVAAIWVASVLFSTLFIAYYDHTAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIARLHKRQRPVHKGFGLKGPVTLTILLGIFFLCWGPFFLHLTLIVLCPEHPTCGCIFKNFNLFLALIICNAIIDPLIYAFHSQELRRTLKEVLTCSW |
| Enzyme Length | 316 |
| Uniprot Accession Number | Q864K9 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Receptor for MSH (alpha, beta and gamma) and ACTH. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. Mediates melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), via regulation of cAMP signaling in melanocytes. {ECO:0000250|UniProtKB:Q01726}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Glycosylation (1); Lipidation (1); Natural variant (1); Topological domain (8); Transmembrane (7) |
| Keywords | Cell membrane;G-protein coupled receptor;Glycoprotein;Lipoprotein;Membrane;Palmitate;Receptor;Reference proteome;Transducer;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell membrane {ECO:0000250|UniProtKB:Q01726}; Multi-pass membrane protein {ECO:0000255}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 34,692 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |