| IED ID | IndEnz0016000095 |
| Enzyme Type ID | tyrosinase000095 |
| Protein Name |
Hemocyanin, units E and F Fragments |
| Gene Name | |
| Organism | Sepia officinalis (Common cuttlefish) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Spiralia Lophotrochozoa Mollusca Cephalopoda (cephalopods) Coleoidea Decapodiformes Sepiida Sepiina Sepiidae (cuttlefish) Sepia Sepia officinalis (Common cuttlefish) |
| Enzyme Sequence | HGLPAQCPNADGTMVHTCCLHGMPTFKLNFDSHFTIKTVVAQNGTELPESILPEATIDRIPPSSHDLESVRGNLVRKNVDRLSLQEVNSLVHALKRMQKDRSSDGFESIACFHALPPLCPNPTAKHRYACCLHGMATFPQWHRLYVVQFEQSLNRHGATVGVPYTDWTYPMKEVPHLLTSEKYTDPFTAVETFNPFNHGHLSLLSPET |
| Enzyme Length | 208 |
| Uniprot Accession Number | P56825 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Hemocyanins are copper-containing oxygen carriers occurring freely dissolved in the hemolymph of many mollusks and arthropods. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Cross-link (2); Disulfide bond (2); Glycosylation (1); Metal binding (4); Non-adjacent residues (1); Non-terminal residue (2); Region (2) |
| Keywords | Copper;Direct protein sequencing;Disulfide bond;Glycoprotein;Metal-binding;Oxygen transport;Repeat;Thioether bond;Transport |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 23,341 |
| Kinetics | |
| Metal Binding | METAL 1; /note=Copper A; /evidence=ECO:0000250; METAL 113; /note=Copper A; /evidence=ECO:0000250; METAL 133; /note=Copper A; /evidence=ECO:0000250; METAL 142; /note=Copper A; /evidence=ECO:0000250 |
| Rhea ID | |
| Cross Reference Brenda |