Detail Information for IndEnz0016000106
IED ID IndEnz0016000106
Enzyme Type ID tyrosinase000106
Protein Name HLA class II histocompatibility antigen, DRB1 beta chain
Human leukocyte antigen DRB1
HLA-DRB1
Gene Name HLA-DRB1
Organism Homo sapiens (Human)
Taxonomic Lineage cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human)
Enzyme Sequence MVCLKLPGGSCMTALTVTLMVLSSPLALSGDTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS
Enzyme Length 266
Uniprot Accession Number P01911
Absorption
Active Site
Activity Regulation
Binding Site BINDING 86; /note="Peptide antigen; self- and pathogen-derived peptide antigen"; /evidence="ECO:0000269|PubMed:31619516, ECO:0000269|PubMed:8145819"; BINDING 90; /note="Peptide antigen; self- and pathogen-derived peptide antigen"; /evidence="ECO:0000269|PubMed:31619516, ECO:0000269|PubMed:8145819"; BINDING 110; /note="Peptide antigen; self- and pathogen-derived peptide antigen"; /evidence="ECO:0000269|PubMed:31619516, ECO:0000269|PubMed:8145819"; BINDING 111; /note="Peptide antigen; self- and pathogen-derived peptide antigen"; /evidence="ECO:0000269|PubMed:31619516, ECO:0000269|PubMed:8145819"; BINDING 122; /note="Peptide antigen; self- and pathogen-derived peptide antigen"; /evidence="ECO:0000269|PubMed:8145819"
Calcium Binding
catalytic Activity
DNA Binding
EC Number
Enzyme Function FUNCTION: A beta chain of antigen-presenting major histocompatibility complex class II (MHCII) molecule. In complex with the alpha chain HLA-DRA, displays antigenic peptides on professional antigen presenting cells (APCs) for recognition by alpha-beta T cell receptor (TCR) on HLA-DRB1-restricted CD4-positive T cells. This guides antigen-specific T-helper effector functions, both antibody-mediated immune response and macrophage activation, to ultimately eliminate the infectious agents and transformed cells (PubMed:29884618, PubMed:22327072, PubMed:27591323, PubMed:8642306, PubMed:15265931, PubMed:31495665, PubMed:16148104). Typically presents extracellular peptide antigens of 10 to 30 amino acids that arise from proteolysis of endocytosed antigens in lysosomes (PubMed:8145819). In the tumor microenvironment, presents antigenic peptides that are primarily generated in tumor-resident APCs likely via phagocytosis of apoptotic tumor cells or macropinocytosis of secreted tumor proteins (PubMed:31495665). Presents peptides derived from intracellular proteins that are trapped in autolysosomes after macroautophagy, a mechanism especially relevant for T cell selection in the thymus and central immune tolerance (PubMed:17182262, PubMed:23783831). The selection of the immunodominant epitopes follows two processing modes: 'bind first, cut/trim later' for pathogen-derived antigenic peptides and 'cut first, bind later' for autoantigens/self-peptides (PubMed:25413013). The anchor residue at position 1 of the peptide N-terminus, usually a large hydrophobic residue, is essential for high affinity interaction with MHCII molecules (PubMed:8145819). {ECO:0000269|PubMed:15265931, ECO:0000269|PubMed:17182262, ECO:0000269|PubMed:22327072, ECO:0000269|PubMed:23783831, ECO:0000269|PubMed:25413013, ECO:0000269|PubMed:27591323, ECO:0000269|PubMed:29884618, ECO:0000269|PubMed:31495665, ECO:0000269|PubMed:8145819, ECO:0000269|PubMed:8642306}.; FUNCTION: Allele DRB1*01:01: Displays an immunodominant epitope derived from Bacillus anthracis pagA/protective antigen, PA (KLPLYISNPNYKVNVYAVT), to both naive and PA-specific memory CD4-positive T cells (PubMed:22327072). Presents immunodominant HIV-1 gag peptide (FRDYVDRFYKTLRAEQASQE) on infected dendritic cells for recognition by TRAV24-TRBV2 TCR on CD4-positive T cells and controls viral load (PubMed:29884618). May present to T-helper 1 cells several HRV-16 epitopes derived from capsid proteins VP1 (PRFSLPFLSIASAYYMFYDG) and VP2 (PHQFINLRSNNSATLIVPYV), contributing to viral clearance (PubMed:27591323). Displays commonly recognized peptides derived from IAV external protein HA (PKYVKQNTLKLAT and SNGNFIAPEYAYKIVK) and from internal proteins M, NP and PB1, with M-derived epitope (GLIYNRMGAVTTEV) being the most immunogenic (PubMed:8145819, PubMed:9075930, PubMed:25413013, PubMed:32668259). Presents a self-peptide derived from COL4A3 (GWISLWKGFSF) to TCR (TRAV14 biased) on CD4-positive, FOXP3-positive regulatory T cells and mediates immune tolerance to self (PubMed:28467828). May present peptides derived from oncofetal trophoblast glycoprotein TPBG 5T4, known to be recognized by both T-helper 1 and regulatory T cells (PubMed:31619516). Displays with low affinity a self-peptide derived from MBP (VHFFKNIVTPRTP) (PubMed:9075930). {ECO:0000269|PubMed:22327072, ECO:0000269|PubMed:25413013, ECO:0000269|PubMed:27591323, ECO:0000269|PubMed:28467828, ECO:0000269|PubMed:29884618, ECO:0000269|PubMed:31619516, ECO:0000269|PubMed:32668259, ECO:0000269|PubMed:8145819, ECO:0000269|PubMed:9075930}.; FUNCTION: Allele DRB1*03:01: May present to T-helper 1 cells an HRV-16 epitope derived from capsid protein VP2 (NEKQPSDDNWLNFDGTLLGN), contributing to viral clearance (PubMed:27591323). Displays self-peptides derived from retinal SAG (NRERRGIALDGKIKHE) and thyroid TG (LSSVVVDPSIRHFDV) (PubMed:25413013). Presents viral epitopes derived from HHV-6B gH/U48 and U85 antigens to polyfunctional CD4-positive T cells with cytotoxic activity implicated in control of HHV-6B infection (PubMed:31020640). Presents several immunogenic epitopes derived from C. tetani neurotoxin tetX, playing a role in immune recognition and long-term protection (PubMed:19830726). {ECO:0000269|PubMed:19830726, ECO:0000269|PubMed:25413013, ECO:0000269|PubMed:27591323, ECO:0000269|PubMed:31020640}.; FUNCTION: Allele DRB1*04:01: Presents an immunodominant bacterial epitope derived from M. tuberculosis esxB/culture filtrate antigen CFP-10 (EISTNIRQAGVQYSR), eliciting CD4-positive T cell effector functions such as IFNG production and cytotoxic activity (PubMed:15265931). May present to T-helper 1 cells an HRV-16 epitope derived from capsid protein VP2 (NEKQPSDDNWLNFDGTLLGN), contributing to viral clearance (PubMed:27591323). Presents tumor epitopes derived from melanoma-associated TYR antigen (QNILLSNAPLGPQFP and DYSYLQDSDPDSFQD), triggering CD4-positive T cell effector functions such as GMCSF production (PubMed:8642306). Displays preferentially citrullinated self-peptides derived from VIM (GVYATR/citSSAVR and SAVRAR/citSSVPGVR) and ACAN (VVLLVATEGR/ CitVRVNSAYQDK) (PubMed:24190431). Displays self-peptides derived from COL2A1 (PubMed:9354468). {ECO:0000269|PubMed:15265931, ECO:0000269|PubMed:24190431, ECO:0000269|PubMed:27591323, ECO:0000269|PubMed:8642306, ECO:0000269|PubMed:9354468}.; FUNCTION: Allele DRB1*04:02: Displays native or citrullinated self-peptides derived from VIM. {ECO:0000269|PubMed:24190431}.; FUNCTION: Allele DRB1*04:04: May present to T-helper 1 cells several HRV-16 epitopes derived from capsid proteins VP1 (HIVMQYMYVPPGAPIPTTRN) and VP2 (RGDSTITSQDVANAVVGYGV), contributing to viral clearance (PubMed:27591323). Displays preferentially citrullinated self-peptides derived from VIM (SAVRAR/citSSVPGVR) (PubMed:24190431). {ECO:0000269|PubMed:24190431, ECO:0000269|PubMed:27591323}.; FUNCTION: Allele DRB1*04:05: May present to T-helper 1 cells an immunogenic epitope derived from tumor-associated antigen WT1 (KRYFKLSHLQMHSRKH), likely providing for effective antitumor immunity in a wide range of solid and hematological malignancies. {ECO:0000269|PubMed:19120973}.; FUNCTION: Allele DRB1*05:01: Presents an immunodominant HIV-1 gag peptide (FRDYVDRFYKTLRAEQASQE) on infected dendritic cells for recognition by TRAV24-TRBV2 TCR on CD4-positive T cells and controls viral load. {ECO:0000269|PubMed:29884618}.; FUNCTION: Allele DRB1*07:01: Upon EBV infection, presents latent antigen EBNA2 peptide (PRSPTVFYNIPPMPLPPSQL) to CD4-positive T cells, driving oligoclonal expansion and selection of a dominant virus-specific memory T cell subset with cytotoxic potential to directly eliminate virus-infected B cells (PubMed:31308093). May present to T-helper 1 cells several HRV-16 epitopes derived from capsid proteins VP1 (PRFSLPFLSIASAYYMFYDG) and VP2 (VPYVNAVPMDSMVRHNNWSL), contributing to viral clearance (PubMed:27591323). In the context of tumor immunesurveillance, may present to T-helper 1 cells an immunogenic epitope derived from tumor-associated antigen WT1 (MTEYKLVVVGAVGVGKSALTIQLI), likely providing for effective antitumor immunity in a wide range of solid and hematological malignancies (PubMed:22929521). In metastatic epithelial tumors, presents to intratumoral CD4-positive T cells a KRAS neoantigen (MTEYKLVVVGAVGVGKSALTIQLI) carrying G12V hotspot driver mutation and may mediate tumor regression (PubMed:30282837). {ECO:0000269|PubMed:22929521, ECO:0000269|PubMed:27591323, ECO:0000269|PubMed:30282837, ECO:0000269|PubMed:31308093}.; FUNCTION: Allele DRB1*11:01: Displays an immunodominant HIV-1 gag peptide (FRDYVDRFYKTLRAEQASQE) on infected dendritic cells for recognition by TRAV24-TRBV2 TCR on CD4-positive T cells and controls viral load (PubMed:29884618). May present to T-helper 1 cells an HRV-16 epitope derived from capsid protein VP2 (SDRIIQITRGDSTITSQDVA), contributing to viral clearance (PubMed:27591323). Presents several immunogenic epitopes derived from C. tetani neurotoxin tetX, playing a role in immune recognition and longterm protection (PubMed:19830726). In the context of tumor immunesurveillance, may present tumor-derived neoantigens to CD4-positive T cells and trigger anti-tumor helper functions (PubMed:31495665). {ECO:0000269|PubMed:19830726, ECO:0000269|PubMed:27591323, ECO:0000269|PubMed:29884618, ECO:0000269|PubMed:31495665}.; FUNCTION: Allele DRB1*13:01: Presents viral epitopes derived from HHV-6B antigens to polyfunctional CD4-positive T cells implicated in control of HHV-6B infection. {ECO:0000269|PubMed:31020640}.; FUNCTION: Allele DRB1*15:01: May present to T-helper 1 cells an HRV-16 epitope derived from capsid protein VP2 (SNNSATLIVPYVNAVPMDSM), contributing to viral clearance (PubMed:27591323). Displays a self-peptide derived from MBP (ENPVVHFFKNIVTPR) (PubMed:9782128, PubMed:25413013). May present to T-helper 1 cells an immunogenic epitope derived from tumor-associated antigen WT1 (KRYFKLSHLQMHSRKH), likely providing for effective antitumor immunity in a wide range of solid and hematological malignancies. {ECO:0000269|PubMed:19120973, ECO:0000269|PubMed:27591323, ECO:0000269|PubMed:9782128}.; FUNCTION: Allele DRB1*15:02: Displays an immunodominant HIV-1 gag peptide (FRDYVDRFYKTLRAEQASQE) on infected dendritic cells for recognition by TRAV24-TRBV2 TCR on CD4-positive T cells and controls viral load (PubMed:29884618). May present to T-helper 1 cells an immunogenic epitope derived from tumor-associated antigen WT1 (KRYFKLSHLQMHSRKH), likely providing for effective antitumor immunity in a wide range of solid and hematological malignancies (PubMed:19120973). {ECO:0000269|PubMed:19120973, ECO:0000269|PubMed:29884618}.; FUNCTION: (Microbial infection) Acts as a receptor for Epstein-Barr virus on lymphocytes. {ECO:0000269|PubMed:11864610, ECO:0000269|PubMed:9151859}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Beta strand (16); Binding site (5); Chain (1); Cross-link (1); Disulfide bond (2); Domain (1); Glycosylation (1); Helix (5); Mutagenesis (8); Natural variant (85); Region (2); Signal peptide (1); Topological domain (2); Transmembrane (1); Turn (3)
Keywords 3D-structure;Adaptive immunity;Cell membrane;Cytoplasmic vesicle;Direct protein sequencing;Disulfide bond;Endoplasmic reticulum;Endosome;Glycoprotein;Immunity;Isopeptide bond;Lysosome;MHC II;Membrane;Reference proteome;Signal;Transmembrane;Transmembrane helix;Ubl conjugation
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:18305173, ECO:0000269|PubMed:19830726, ECO:0000269|PubMed:29884618}; Single-pass type I membrane protein {ECO:0000255}. Endoplasmic reticulum membrane {ECO:0000269|PubMed:18305173}; Single-pass type I membrane protein {ECO:0000255}. Lysosome membrane {ECO:0000269|PubMed:18305173, ECO:0000269|PubMed:9075930}; Single-pass type I membrane protein {ECO:0000255}. Late endosome membrane {ECO:0000269|PubMed:18305173, ECO:0000269|PubMed:9075930}; Single-pass type I membrane protein {ECO:0000255}. Autolysosome membrane {ECO:0000269|PubMed:17182262}. Note=The MHC class II complex transits through a number of intracellular compartments in the endocytic pathway until it reaches the cell membrane for antigen presentation (PubMed:18305173). Component of immunological synapses at the interface between T cell and APC (PubMed:29884618). {ECO:0000269|PubMed:18305173, ECO:0000269|PubMed:29884618}.
Modified Residue
Post Translational Modification PTM: Ubiquitinated by MARCHF1 and MARCHF8 at Lys-254 leading to sorting into the endosome system and down-regulation of MHCII. {ECO:0000305|PubMed:18305173}.
Signal Peptide SIGNAL 1..29; /evidence="ECO:0000269|PubMed:6600932, ECO:0000269|PubMed:6947956"
Structure 3D X-ray crystallography (98)
Cross Reference PDB 1A6A; 1AQD; 1BX2; 1D5M; 1D5X; 1D5Z; 1D6E; 1DLH; 1FYT; 1HXY; 1J8H; 1JWM; 1JWS; 1JWU; 1KG0; 1KLG; 1KLU; 1LO5; 1PYW; 1R5I; 1SEB; 1SJE; 1SJH; 1T5W; 1T5X; 1YMM; 2FSE; 2G9H; 2IAM; 2IAN; 2ICW; 2IPK; 2OJE; 2SEB; 2WBJ; 2XN9; 3L6F; 3O6F; 3PDO; 3PGC; 3PGD; 3QXA; 3QXD; 3S4S; 3S5L; 3T0E; 4AEN; 4AH2; 4C56; 4E41; 4FQX; 4GBX; 4I5B; 4IS6; 4MCY; 4MCZ; 4MD0; 4MD4; 4MD5; 4MDI; 4MDJ; 4OV5; 4X5W; 4X5X; 4Y19; 4Y1A; 5JLZ; 5LAX; 5NI9; 5NIG; 6BIJ; 6BIL; 6BIN; 6BIR; 6BIV; 6BIX; 6BIY; 6BIZ; 6CPL; 6CPN; 6CPO; 6CQJ; 6CQL; 6CQN; 6CQQ; 6CQR; 6HBY; 6NIX; 6QZA; 6QZC; 6QZD; 6R0E; 6V0Y; 6V13; 6V15; 6V18; 6V19; 6V1A;
Mapped Pubmed ID 10036229; 10064083; 10072072; 10480952; 10540230; 10593899; 10631941; 10631952; 10748235; 10811803; 10841792; 11048639; 11060013; 11082517; 11167958; 11168337; 11169240; 11169241; 11169242; 11169267; 11171832; 11179016; 11181188; 11182227; 11196513; 11202431; 11222331; 11229460; 11229461; 11246532; 11246655; 11250044; 11250046; 11251689; 11257148; 11260506; 11260508; 11261326; 11263477; 11263767; 11266078; 11267248; 11272094; 11285127; 11285131; 11288988; 11289148; 11291046; 11294566; 11318984; 11320565; 11334675; 11334677; 11349219; 11359453; 11374095; 11378822; 11390038; 11393660; 11409118; 11409121; 11423176; 11423179; 11423504; 11424637; 11436079; 11454644; 11469465; 11474249; 11476905; 11476906; 11477477; 11480844; 11482129; 11495087; 11500439; 11502807; 11507979; 11519010; 11529500; 11543892; 11543893; 11555411; 11558319; 11574100; 11580849; 11588129; 11672906; 11678027; 11678832; 11679920; 11684289; 11704283; 11704285; 11704803; 11724419; 11742191; 11744483; 11751969; 11752630; 11756990; 11776098; 11780465; 11782272; 11782575; 11790530; 11791643; 11797339; 11799174; 11802942; 11802982; 11812768; 11819862; 11821160; 11824952; 11827988; 11836687; 11839711; 11841366; 11841481; 11841486; 11841488; 11841495; 11842822; 11853874; 11857064; 11857065; 11860796; 11860824; 11865153; 11868921; 11870103; 11872237; 11872240; 11873625; 11877480; 11881821; 11886480; 11888582; 11894970; 11895223; 11903620; 11904677; 11914753; 11916167; 11920855; 11923913; 11929589; 11929590; 11935333; 11950806; 11953976; 11961170; 11972875; 11972877; 11972878; 11972881; 11978563; 11979305; 11984513; 11985790; 11994765; 11997714; 12008082; 12010826; 12021129; 12021131; 12021137; 12021139; 12021152; 12022354; 12022360; 12028537; 12028548; 12028549; 12030733; 12039413; 12047362; 12048293; 12051920; 12058255; 12070003; 12071546; 12072187; 12073071; 12075003; 12077712; 12078484; 12083823; 12089669; 12095976; 12098513; 12100571; 12100686; 12109964; 12115177; 12121274; 12121676; 12124858; 12124873; 12125959; 12126569; 12134251; 12136889; 12137324; 12139680; 12144077; 12144619; 12144621; 12144622; 12144623; 12144625; 12144632; 12145745; 12149602; 12150008; 12150055; 12166499; 12169181; 12170464; 12188437; 12195370; 12196893; 12198549; 12198621; 12208877; 12209103; 12209487; 12211723; 12212234; 12233873; 12235085; 12235090; 12270547; 12296785; 12351419; 12355479; 12358152; 12358854; 12362498; 12364641; 12366783; 12373032; 12375325; 12376743; 12390851; 12391221; 12392510; 12392614; 12392856; 12392857; 12392858; 12415586; 12415587; 12418392; 12443029; 12445309; 12445315; 12445316; 12445319; 12447731; 12455817; 12455867; 12464650; 12467569; 12472657; 12473184; 12477229; 12482190; 12482357; 12485116; 12486606; 12486608; 12506649; 12507821; 12507822; 12507825; 12508396; 12508774; 12508775; 12525627; 12526952; 12528108; 12541760; 12542740; 12543794; 12559632; 12559635; 12574360; 12579512; 12581796; 12590981; 12594107; 12595908; 12605834; 12610047; 12618858; 12620968; 12622778; 12622783; 12632487; 12635863; 12635936; 12648281; 12649403; 12651073; 12651074; 12651075; 12654235; 12656131; 12658812; 12660263; 12663229; 12665835; 12671736; 12687213; 12687342; 12687511; 12694574; 12694583; 12694584; 12694585; 12694587; 12694588; 12716485; 12721936; 12729048; 12734793; 12748383; 12753657; 12753667; 12765483; 12770791; 12770797; 12771724; 12774051; 12778456; 12786999; 12787001; 12793199; 12794545; 12794845; 12798452; 12811505; 12820921; 12823766; 12823767; 12823769; 12825172; 12826377; 12835080; 12841565; 12845430; 12845730; 12846065; 12858445; 12858454; 12859593; 12859598; 12867584; 12870731; 12878355; 12878360; 12878361; 12878363; 12887819; 12888330; 12889993; 12903044; 12903056; 12903490; 12905660; 12911663; 12917840; 12917841; 12919753; 12921878; 12934467; 12939427; 12941076; 12941545; 12941546; 12941547; 12941548; 12942703; 12947224; 12952957; 12956878; 12960752; 12962633; 12974796; 14504973; 14510693; 14510801; 14522089; 14522093; 14527201; 14530370; 14558083; 14562382; 14567462; 14570623; 14571756; 14572343; 14578453; 14581545; 14581671; 14582328; 14592217; 14602216; 14617033; 14617034; 14617035; 14617036; 14630402; 14641517; 14648147; 14651137; 14651518; 14651526; 14656748; 14662898; 14669136; 14673570; 14675393; 14677183; 14679080; 14680508; 14686115; 14690140; 14693734; 14694619; 14700595; 14700596; 14700597; 14700598; 14700599; 14714495; 14718045; 14719586; 14730600; 14731593; 14740435; 14745491; 14748996; 14749980; 14752708; 14760938; 14769517; 14872482; 14872499; 14962388; 14964841; 14976194; 14976605; 14995006; 15000695; 15003812; 15009177; 15009181; 15009432; 15009808; 15013978; 15014429; 15016191; 15016308; 15018649; 15019280; 15019597; 15022316; 15029234; 15030582; 15037989; 15041166; 15041167; 15046222; 15046556; 15049049; 15055474; 15057268; 15057902; 15061705; 15065436; 15070884; 15075536; 15077289; 15081263; 15083289; 15084594; 15086350; 1508672; 15089899; 15089901; 15096192; 15102786; 15104683; 15116308; 15120191; 15120192; 15121303; 15122136; 15124939; 15128924; 15140072; 15142265; 15144462; 15144476; 15157381; 15158329; 15158619; 15164528; 15175643; 15175852; 15182324; 15185301; 15188377; 15191519; 15191529; 15191530; 15191952; 15192840; 15194283; 15194331; 15199166; 15202948; 15203870; 15218339; 15219382; 15219383; 15227724; 15228651; 15228652; 15231205; 15237447; 15239092; 15242955; 15243926; 15245369; 15245541; 15248208; 15248209; 15250035; 15251317; 15256073; 15256088; 15257408; 15265024; 15269854; 15275783; 15300424; 15304010; 15304011; 15304012; 15304013; 15304014; 15304015; 15305234; 15305244; 15305487; 15307871; 15310011; 15311520; 15321756; 15323271; 15325795; 15331395; 15331779; 15334474; 15336778; 15336779; 15336786; 15338498; 15338511; 15343265; 15350494; 15357778; 15358536; 15361127; 15361135; 15372502; 15388265; 15448101; 15449022; 15452304; 15457442; 15462607; 15468351; 15471368; 15471889; 15476187; 15476204; 15476205; 15479890; 15489166; 15489910; 15489916; 15492185; 15496200; 15496201; 15505772; 15507397; 15513680; 15522921; 15529352; 15529361; 15529363; 15529553; 15530631; 15531903; 15533584; 15535834; 15546341; 15548263; 15554365; 15555263; 15556690; 15561961; 15565951; 15570643; 15572392; 15585555; 15602199; 15603874; 15603876; 15613143; 15620466; 15621102; 15625617; 15626888; 15627041; 15629656; 15640103; 15640334; 15640608; 15641099; 15642902; 15643010; 15645749; 15650879; 15655774; 15660729; 15663743; 15664787; 15665016; 15666025; 15683420; 15688398; 15690658; 15696102; 15699400; 15699512; 15703453; 15712014; 15713215; 15713222; 15719619; 15721314; 15728986; 15730527; 15730926; 15734871; 15735647; 15735807; 15743917; 15747244; 15749704; 15750822; 15763345; 15770496; 15784113; 15784468; 15785242; 15786423; 15789899; 15821740; 15825968; 15833172; 15834022; 15846589; 15849775; 15851575; 15853900; 15853901; 15853903; 15853910; 15854278; 15856071; 15858601; 15863864; 15881283; 15885635; 15896210; 15898419; 15901902; 15902698; 15906352; 15908298; 15911768; 15929613; 15932622; 15934994; 15935893; 15941540; 15943829; 15952133; 15958261; 15969672; 15975271; 15982254; 15982255; 15982256; 15982264; 15982265; 15985473; 15993714; 15993720; 16005098; 16005527; 16007032; 16011982; 16014635; 16014670; 16019679; 16025255; 16026587; 16029431; 16042197; 16049290; 16053028; 16086294; 16086295; 16094724; 16095006; 16095118; 16096810; 16096857; 16098233; 16101833; 16101838; 16101839; 16103458; 16107511; 16107953; 16112029; 16112030; 16116311; 16122986; 16126967; 16130422; 16133177; 16142706; 16142711; 16143070; 16148166; 16155070; 16157380; 16158194; 16173256; 16174649; 16180280; 16185329; 16186814; 16188098; 16188937; 16198136; 16200610; 16201295; 16208405; 16215732; 16215957; 16226480; 16237774; 16242130; 16245224; 16249228; 16254435; 16255019; 16255021; 16261886; 16263823; 16267409; 16267776; 16269080; 16276008; 16277691; 16277843; 16277897; 16279844; 16286957; 16292086; 16297186; 16303674; 16314951; 16320082; 16320316; 16321988; 16337001; 16343061; 16352685; 16356649; 16358956; 16361713; 16362659; 16364187; 16365741; 16366416; 16385499; 16386646; 16386648; 16386651; 16390390; 16390391; 16405603; 16409303; 16417614; 16420246; 16426240; 16426241; 16426242; 16430717; 16433795; 16437632; 16438485; 16441486; 16441488; 16441489; 16441501; 16441502; 16447236; 16451199; 16451208; 16453260; 16456797; 16456799; 16456803; 16461343; 16463424; 16467040; 16473309; 16481299; 16490755; 16495319; 16496287; 16507114; 16518608; 16530511; 16532100; 16533342; 16537577; 16540751; 16555323; 16566202; 16572445; 16572446; 16573562; 16584643; 16604510; 16606409; 16609350; 16611256; 16611259; 16618111; 16629714; 16646680; 16646982; 16671949; 16673133; 16689106; 16698432; 16700999; 16704757; 16709874; 16712649; 16714073; 16720210; 16720213; 16720214; 16731854; 16733891; 16756466; 16767683; 16769963; 16773677; 16778420; 16786764; 16792590; 16793843; 16796128; 16799707; 16802776; 16815190; 16824007; 16826237; 16829307; 16829309; 16829512; 16846526; 16849401; 16855521; 16855621; 16857416; 16866883; 16866885; 16875346; 16879301; 16879749; 16883532; 16884876; 16887863; 16890179; 16905561; 16916662; 16923796; 16935351; 16935791; 16941709; 16948649; 16951351; 16960929; 16964961; 16966600; 16972006; 16978534; 16988007; 17002902; 17002906; 17003171; 17003176; 17016821; 17021767; 17026463; 17026464; 17026471; 17028803; 17047287; 17050030; 17052889; 17054449; 17055527; 17056584; 17060025; 17075818; 17075829; 17086601; 17092866; 17105585; 17106278; 17106689; 17113829; 17116345; 17119950; 17124999; 17126830; 17130528; 17130566; 17130569; 17133612; 17143607; 17144392; 17153701; 17166841; 17180363; 17182961; 17186951; 17198869; 17207378; 17207713; 17207714; 17212707; 17212710; 17215337; 17220897; 17223660; 17227111; 17234427; 17237562; 17252545; 17256150; 17257318; 17257319; 17257320; 17265477; 17266100; 17283181; 17284220; 17284224; 17285554; 17285557; 17287608; 17288808; 17294607; 17299710; 17301827; 17304884; 17305280; 17306585; 17309132; 17309450; 17310371; 17311339; 17318773; 17324966; 17325942; 17328818; 17329717; 17334368; 17334650; 17341285; 17341507; 17349874; 17350686; 17351628; 17364902; 17376212; 17378697; 17383044; 17384941; 17387388; 17388766; 17389012; 17389014; 17389015; 17392350; 17396103; 17401504; 17406641; 17406941; 17407088; 17412364; 17428358; 17433060; 17436241; 17437273; 17445172; 17445173; 17453717; 17455230; 17458393; 17460569; 17462511; 17463066; 17469097; 17469103; 17488703; 17489060; 17489940; 17491100; 17493158; 17493347; 17498269; 17509091; 17509453; 17510796; 17513705; 17516530; 17531857; 17534404; 17537386; 17538887; 17541908; 17543145; 17546694; 17554059; 17554341; 17559577; 17559688; 17561243; 17573956; 17578051; 17578052; 17583734; 17584581; 17584585; 17584771; 17588142; 17589850; 17592398; 17603847; 17604825; 17610416; 17610417; 17622942; 17629023; 17631742; 17652306; 17652848; 17652849; 17653284; 17653770; 17658488; 17660221; 17661908; 17661909; 17661910; 17662002; 17662350; 17662890; 17665209; 17666451; 17672065; 17673320; 17673491; 17680546; 17681614; 17686102; 17714418; 17714554; 17714903; 17715334; 17722299; 17722421; 17726164; 17728335; 17761456; 17763415; 17763436; 17767551; 17785583; 17785916; 17825227; 17826339; 17845076; 17845310; 17869653; 17875181; 17876645; 17878210; 17891921; 17893434; 17895416; 17900288; 17901090; 17907045; 17910142; 17911417; 17911430; 17922429; 17927716; 17928868; 17935228; 17936227; 17947711; 17956579; 17961775; 17961971; 17964196; 17971048; 17971052; 17971177; 17972102; 17977208; 17982455; 17987563; 17989341; 17989838; 17992468; 17997607; 18000641; 18001297; 18001300; 18003662; 18007983; 18022570; 18022727; 18028350; 18032542; 18036100; 18036860; 18038917; 18039812; 18046453; 18053473; 18057318; 18057383; 18057683; 18058064; 18064508; 18065518; 18069933; 18070207; 18070287; 18070336; 18071880; 18077428; 18082572; 18084828; 18085741; 18085998; 18086264; 18086267; 18087043; 18088468; 18088469; 18093280; 18156150; 18162709; 18163478; 18164964; 18167262; 18173375; 18176993; 18177450; 18186801; 18196245; 18203322; 18222012; 18223493; 18236804; 18240241; 18240242; 18240960; 18241227; 18244920; 18248305; 18252895; 18256425; 18257894; 18258695; 18259107; 18267980; 18270855; 18272668; 18272866; 18275683; 18277084; 18279373; 18289678; 18292509; 18292987; 18295677; 18295738; 18300568; 18301070; 18301962; 18307784; 18309376; 18312478; 18312480; 18316396; 18320121; 18331414; 18332066; 18332098; 18334870; 18338763; 18345414; 18347100; 18351579; 18352820; 18356404; 18362138; 18367833; 18371160; 18372357; 18378005; 18381784; 18381799; 18385790; 18390988; 18395773; 18396213; 18397187; 18398946; 18399156; 18401352; 18408250; 18408266; 18412308; 18413431; 18416774; 18433881; 18438843; 18449200; 18449568; 18450852; 18451182; 18463715; 18465452; 18466466; 18466483; 18466515; 18466541; 18481581; 18482373; 18486765; 18487476; 18489735; 18501999; 18504544; 18513341; 18520158; 18520346; 18521924; 18523312; 18523354; 18535809; 18537178; 18544086; 18554163; 18561316; 18565246; 18565258; 18565729; 18569076; 18571007; 18580885; 18582515; 18583252; 18588574; 18589099; 18593440; 18599937; 18613417; 18615093; 18623133; 18635594; 18656179; 18683155; 18684745; 18684978; 18689790; 18694972; 18706091; 18713991; 18716994; 18718089; 18721271; 18721277; 18721466; 18722491; 18726686; 18759926; 18761557; 18764812; 18765817; 18778327; 18779568; 18780165; 18789688; 18791284; 18794605; 18797890; 18799094; 18801688; 18812394; 18820539; 18821214; 18822201; 18824733; 18827882; 18832704; 18835879; 18838388; 18846964; 18854880; 18922348; 18930994; 18932050; 18945361; 18952831; 18955791; 18955792; 18958335; 18976432; 18976433; 18976440; 18987644; 18996998; 18998014; 19000139; 19000140; 19000142; 19000143; 19002558; 19003916; 19005023; 19022862; 19023492; 19024262; 19030725; 19031816; 19032829; 19035513; 19041429; 19046300; 19046302; 19046304; 19047245; 19052350; 19052351; 19052923; 19055605; 19058789; 19070257; 19096254; 19098025; 19104471; 19116921; 19116923; 19117368; 19117726; 19120272; 19120278; 19124916; 19127112; 19136661; 19140826; 19140832; 19143810; 19143811; 19143812; 19143813; 19143814; 19143818; 19143821; 19144284; 19151010; 19153174; 19155468; 19156166; 19159415; 19165231; 19167759; 19180512; 19188433; 19193207; 19196481; 19197344; 19199253; 19199259; 19200828; 19201236; 19204159; 19204171; 19208355; 19210322; 19210888; 19214504; 19219503; 19221531; 19223392; 19227412; 19230187; 19232439; 19233472; 19235017; 19235869; 19243543; 19247821; 19248090; 19251712; 19254248; 19254255; 19254257; 19262578; 19272325; 19286445; 19287509; 19290000; 19295542; 19299434; 19327239; 19327846; 19332095; 19332633; 19333928; 19333936; 19333951; 19337647; 19348686; 19349081; 19350523; 19364369; 19364514; 19380721; 19382529; 19382531; 19387463; 19390203; 19392788; 19392836; 19401421; 19404393; 19405864; 19407364; 19409091; 19411391; 19411392; 19416238; 19421224; 19429597; 19433080; 19439981; 19445991; 19473214; 19473559; 19474744; 19479873; 19480851; 19481774; 19482865; 19482867; 19486004; 19487610; 19487887; 19490211; 19490212; 19493233; 19493234; 19493426; 19495996; 19500315; 19502265; 19516267; 19523767; 19539218; 19543371; 19544559; 19553558; 1956401; 19564404; 19565552; 19571811; 19585166; 19585495; 19587357; 19589487; 19592628; 19593744; 19596691; 19597844; 19616314; 19624613; 19625333; 19629136; 19630074; 19648126; 19648278; 19653987; 19654074; 19654407; 19654554; 19654877; 19655145; 19659809; 19663932; 19664674; 19668019; 19674013; 19674023; 19683555; 19690132; 19692729; 19698125; 19700393; 19702653; 19703234; 19703245; 19714482; 19714585; 19720533; 19722042; 19728932; 19733917; 19738989; 19740903; 19741008; 19741715; 19744147; 19756183; 19758197; 19758198; 19758199; 19758202; 19758204; 19758311; 19761839; 19769302; 19776016; 19811436; 19811437; 19811438; 19817985; 19819281; 19820007; 19820376; 19822091; 19833889; 19834793; 19837788; 19845915; 19847191; 19851445; 19854714; 19858318; 19860590; 19860744; 19861144; 19865101; 19865102; 19874322; 19879194; 19879597; 19879913; 19884265; 19884273; 19886988; 19890026; 19894308; 19895570; 19896518; 19896562; 19898480; 19908388; 19920092; 19922436; 19924143; 19925877; 19927159; 19931565; 19937591; 19949652; 19956544; 19956635; 19965521; 19995845; 19995849; 20002609; 20003135; 20003137; 20003324; 20003377; 20006387; 20008659; 20017299; 20018638; 20018961; 20028711; 20030936; 20031464; 20038641; 20051322; 20054547; 20062572; 20070603; 20073143; 20073992; 20075704; 20082482; 20083660; 20090103; 20095337; 20101097; 20105138; 20108780; 20112396; 20141578; 20145915; 20147981; 20149160; 20150397; 20154067; 20164547; 20169624; 20170930; 20179740; 20187937; 20191587; 20191588; 20193235; 20193456; 20193583; 20196825; 20196826; 20196860; 20205319; 20207784; 20209134; 20210922; 20211854; 20214848; 20216938; 20221424; 20224785; 20225292; 20230522; 20230525; 20233754; 20235791; 20237121; 20298583; 20303356; 20307907; 20309863; 20331476; 20335276; 20345872; 20345929; 20346252; 20346773; 20347497; 20352225; 20353580; 20353806; 20370905; 20371654; 20374297; 20375311; 20380521; 20380523; 20383728; 20385791; 20387488; 20392899; 20394989; 20395221; 20403136; 20403137; 20405713; 20417641; 20424860; 20426625; 20437569; 20438789; 20439292; 20444266; 20448347; 20449807; 20462405; 20462916; 20463743; 20466734; 20476860; 20478772; 20486920; 20492596; 20492599; 20493227; 20497637; 20502044; 20507388; 20510319; 20518845; 20518846; 20522201; 20522202; 20522537; 20533289; 20536911; 20537173; 20537664; 20541027; 20542071; 20547426; 20549830; 20550778; 20559009; 20560812; 20561992; 20569042; 20580654; 20580995; 20584722; 20586801; 20591987; 20592276; 20593013; 20594918; 20595243; 20595679; 20600444; 20603341; 20603497; 20606439; 20617178; 20627832; 20629714; 20631027; 20634196; 20637045; 20639266; 20639878; 20666704; 20668555; 20670332; 20670354; 20671941; 20678810; 20684489; 20685690; 20685768; 20686866; 20691532; 20692483; 20694011; 20711174; 20719952; 20722010; 20723328; 20725783; 20735759; 20736246; 20739684; 20797713; 20798335; 20800921; 20810130; 20825955; 20837527; 20842443; 20843162; 20849588; 20850383; 20851016; 20854863; 20858521; 20861181; 20876154; 20884011; 20888281; 20919945; 20923326; 20923327; 20931685; 20933106; 20937338; 20966625; 20970669; 20972469; 20974205; 20977916; 21029659; 21031025; 21033293; 21040492; 21059595; 21059899; 21062236; 21063024; 21067287; 21067577; 21072187; 21074862; 21075156; 21079793; 21081917; 21087485; 21087494; 21091360; 21115828; 21116285; 21131964; 21149397; 21172035; 21179106; 21186201; 2121367; 21241376; 21246357; 21251479; 21270202; 21280007; 21282506; 21288988; 21292329; 21297580; 21299892; 21303861; 21316924; 21325036; 21340025; 21342137; 21354458; 21358010; 21360493; 21373184; 21388361; 21395562; 21396892; 21410658; 21411354; 21413052; 21417892; 21418440; 21422625; 21422655; 21429451; 21431378; 21441454; 21447263; 21484216; 21497601; 21501120; 21507567; 21535077; 21543337; 21554253; 21557256; 21569485; 21593777; 21598828; 21599852; 21614018; 21617122; 21621859; 21644227; 21646624; 21652028; 21653833; 21659045; 21676191; 21699788; 21709571; 21712058; 21716163; 21720852; 21732917; 21739420; 21741664; 21744463; 21748712; 21751159; 21762745; 21796887; 21806423; 21809595; 21816002; 21816760; 21820153; 21833018; 21833019; 21851420; 21873689; 21881596; 21888287; 21891926; 21898163; 2190094; 21908482; 21911185; 21924912; 21929573; 21952999; 21955839; 21964432; 21978430; 21982422; 22028790; 22033527; 22041925; 22042692; 22057263; 22068554; 22074998; 22074999; 22084083; 22094856; 22096508; 22106694; 22112985; 22119882; 22122841; 22127897; 22156484; 22166691; 22170232; 22186711; 22196942; 22204478; 22219324; 22224635; 22233603; 22234791; 22244918; 22253788; 22284614; 22286648; 22289117; 22289814; 22307773; 22308705; 22310063; 22310618; 22311500; 22339947; 22357454; 22363536; 22366579; 22367481; 22370504; 22391763; 22404765; 22426112; 22431638; 22433715; 22448298; 22461888; 22487840; 22494469; 22499074; 22504415; 22509268; 22521184; 22523259; 22531795; 22537824; 22554526; 22564118; 22572536; 22573116; 22578019; 22580214; 22588649; 22594481; 22595829; 22633068; 22649493; 22661643; 22671039; 22701553; 22723597; 22731780; 22733780; 22781039; 22803655; 22807207; 22820093; 22848563; 22862152; 22862923; 22863772; 22868506; 22886382; 22889831; 22892251; 22893315; 22898764; 22912672; 22913598; 22935200; 22938381; 22991974; 23010279; 23053058; 23090223; 23110937; 23119005; 23130884; 23139797; 23171011; 23176610; 23177929; 23180035; 23180817; 23183775; 23184486; 23186557; 23200758; 23218978; 23225889; 23232601; 23243276; 23246582; 23257407; 23278646; 23283466; 23291585; 23302880; 23303446; 23312038; 23317308; 23318129; 23321172; 23321320; 23328091; 23331206; 23376085; 23378606; 23380141; 23380142; 23387390; 23391249; 23392276; 23398374; 23402837; 23404077; 23413297; 23421483; 23454623; 23462545; 23477965; 23485854; 23502333; 23507476; 23537298; 23543758; 23551624; 23555757; 23555798; 23556450; 23577190; 23580664; 23588515; 23590002; 23593151; 23596045; 23613482; 23628399; 23636221; 23636621; 23637323; 23638805; 23674880; 23724919; 23737967; 23739956; 23742216; 23791106; 23793098; 23793423; 23809616; 23834030; 23835632; 23837503; 23849771; 2391366; 23951151; 23953521; 23958186; 23968403; 23976922; 23992015; 23993985; 23994122; 24024195; 24029438; 24033735; 24046013; 24055898; 24103024; 24103044; 24108701; 24161032; 24260237; 24268496; 24282030; 24295149; 24297382; 24316141; 24321473; 24336351; 24366815; 24381092; 24397488; 24403192; 24447879; 24490781; 24491062; 24500647; 24517468; 24551099; 24597629; 24598797; 24602055; 24618287; 24628273; 24632584; 24641503; 24661105; 24691290; 24724911; 24738569; 24758334; 24760193; 24763718; 24793468; 24806356; 24853027; 24903971; 24911054; 24919928; 24962747; 24963477; 24964187; 24970932; 24979673; 24988556; 25002586; 25009391; 25015819; 25034406; 25037176; 25064442; 25078644; 25103892; 25119922; 25130147; 25184637; 25217962; 25223600; 25225671; 25244652; 25249698; 25256132; 25274017; 25298310; 2530588; 25324153; 25325831; 25329634; 25337265; 25346274; 25365775; 25382027; 25383971; 25413106; 25506722; 25521205; 25524867; 25531278; 25533202; 25582808; 25582848; 25604634; 25611558; 25626601; 25634309; 25636569; 25636572; 25651370; 25665771; 25666956; 25673541; 25698175; 25700963; 25708101; 25732927; 25777156; 25787085; 25817017; 25824849; 25832994; 25833145; 25845749; 25911099; 25916813; 25926086; 25953150; 25965561; 25971824; 25975240; 25992516; 26022697; 26056112; 26088816; 26091715; 26119197; 26129806; 26168013; 26198919; 26199258; 26235935; 26307177; 26312389; 26362370; 26367070; 26392055; 26393471; 26437244; 26446064; 26456283; 26473500; 26475924; 26498496; 26546900; 26566811; 26585430; 26598658; 26605347; 26615796; 26634553; 26656273; 26663868; 26671138; 26684212; 26688538; 26740600; 26744784; 26769066; 26769539; 26780502; 26787110; 26807576; 26818122; 26822082; 26829749; 26844284; 26854192; 26894280; 26901036; 26915265; 26919467; 26953725; 26959717; 26967484; 26990204; 27000234; 27013183; 27027642; 27036319; 27049564; 27056075; 27059731; 27063556; 27088644; 27095065; 27100735; 27102235; 27105925; 27106586; 27116456; 27143337; 27166610; 27181214; 27184863; 27214100; 27216775; 27231174; 27241705; 27274008; 27301744; 27339331; 27348021; 27355582; 27372294; 27388144; 27412376; 27414259; 27417521; 27435705; 27496342; 27503745; 27505846; 27511600; 27511726; 27521249; 27534049; 27535842; 27558072; 27580864; 27581220; 27599848; 27601657; 27611583; 27623983; 27662826; 27666425; 27713094; 27713139; 27753285; 27759901; 27760141; 27788190; 27808488; 27821814; 27827392; 27839692; 27861807; 27866840; 27873324; 27883235; 27895642; 27917778; 27943654; 28013432; 28019029; 28026029; 28026046; 28028136; 28052112; 28079238; 28086002; 28110239; 28118524; 28131168; 28182665; 28197992; 28224433; 28247576; 28270189; 28342268; 28369180; 28374975; 28391248; 28431892; 28474969; 28495048; 28570922; 28575531; 28597127; 28612994; 28675059; 28677168; 28711882; 28786423; 28801345; 28806749; 28875928; 28881103; 28899403; 28902578; 28919586; 28931918; 28981958; 2901408; 29025870; 29030599; 29036181; 29037901; 29067976; 29088299; 29106035; 29106857; 29145880; 29168332; 29174716; 29257902; 29270995; 29307888; 29315655; 29317506; 29321349; 29362509; 29369163; 29393768; 29421495; 29439646; 29452862; 29483183; 29521573; 29562276; 29582441; 29582787; 29624881; 29683085; 29691938; 29853344; 29900885; 29902106; 29905830; 29908012; 29921915; 29941324; 29957381; 29958949; 29967194; 29979892; 29979894; 30004835; 30037801; 30042143; 30045250; 30074211; 30081155; 30095639; 30136608; 30175673; 30246695; 30251731; 30306282; 30349113; 30352277; 30379846; 30403401; 30636700; 30653506; 30679605; 30836273; 30875612; 30906300; 30910980; 31038287; 31038770; 31050006; 31174489; 31211758; 31242791; 31272097; 31299142; 31313885; 31333131; 31339184; 31358984; 31408393; 31412073; 31451934; 31505924; 31537466; 31540313; 31570816; 31576671; 31624234; 31742498; 31770283; 31882398; 31891288; 31981624; 31994854; 32008155; 32073448; 32141793; 32167241; 32183601; 32227529; 32234402; 32240434; 32244438; 32247967; 32350356; 32418312; 32462780; 32467566; 32476964; 32483903; 32568442; 32693207; 32693929; 32783376; 32898759; 32928608; 32967480; 33002286; 33002571; 33058932; 33086995; 33139618; 33168359; 33217039; 33386169; 33420337; 33547763; 33565267; 33575923; 33586351; 33589587; 33591409; 33657520; 33675036; 33725525; 33734601; 33734973; 33754173; 33821842; 33837995; 33863750; 34016546; 34017081; 34019695; 34145318; 34153873; 34248985; 34255440; 34325227; 34335597; 34374349; 34379040; 34492482; 34686989; 34714525; 35115410; 7481823; 7530745; 7592972; 7650016; 7667286; 8046351; 8134367; 8148318; 8176225; 8313912; 8397411; 8415765; 8483949; 8520027; 8530158; 8642258; 8687433; 8849454; 8909537; 8939989; 8947036; 9143706; 9202021; 9311912; 9312039; 9351812; 9497313; 9545226; 9606180; 9850860;
Motif
Gene Encoded By
Mass 29,966
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda