| IED ID |
IndEnz0016000177 |
| Enzyme Type ID |
tyrosinase000177 |
| Protein Name |
Tyrosinase cofactor
|
| Gene Name |
melC1 |
| Organism |
Streptomyces galbus |
| Taxonomic Lineage |
cellular organisms
Bacteria
Terrabacteria group
Actinobacteria
Actinomycetia (high G+C Gram-positive bacteria)
Streptomycetales
Streptomycetaceae
Streptomyces
Streptomyces galbus
|
| Enzyme Sequence |
MPDITRRRAYTTAAAVAATASAAAPTAAPAATAAARHDHTAPDSFDEVYKGRRIQGGPASGGGHHHEHGGGYAVFVDGVQLHVMQNADGTWISVVSHYAPVATPRAAARAAVDELQGAPLLPFPTN |
| Enzyme Length |
126 |
| Uniprot Accession Number |
P55046 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: This protein may function to deliver copper to tyrosinase. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Region (1); Signal peptide (1) |
| Keywords |
Copper;Melanin biosynthesis;Signal |
| Interact With |
|
| Induction |
|
| Subcellular Location |
|
| Modified Residue |
|
| Post Translational Modification |
PTM: Predicted to be exported by the Tat system. The position of the signal peptide cleavage has not been experimentally proven. |
| Signal Peptide |
SIGNAL 1..33; /note=Tat-type signal; /evidence=ECO:0000255|PROSITE-ProRule:PRU00648 |
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
12,916 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|