| IED ID | IndEnz0016000204 |
| Enzyme Type ID | tyrosinase000204 |
| Protein Name |
Tyrosinase cofactor ORF438 |
| Gene Name | melC1 |
| Organism | Streptomyces antibioticus |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Actinobacteria Actinomycetia (high G+C Gram-positive bacteria) Streptomycetales Streptomycetaceae Streptomyces Streptomyces antibioticus |
| Enzyme Sequence | MPELTRRRALGAAAVVAAGVPLVALPAARADDRGHHTPEVPGNPAASGAPAAFDEIYKGRRIQGRTVTDGGGHHGGGHGGDGHGGGHHGGGYAVFVDGVELHVMRNADGSWISVVSHYEPVDTPRAAARAAVDELQGARLLPFPSN |
| Enzyme Length | 146 |
| Uniprot Accession Number | P17687 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: This protein may function to deliver copper to tyrosinase. {ECO:0000269|PubMed:2840357}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Region (1); Signal peptide (1) |
| Keywords | Copper;Melanin biosynthesis;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | PTM: Predicted to be exported by the Tat system. The position of the signal peptide cleavage has not been experimentally proven. |
| Signal Peptide | SIGNAL 1..30; /note=Tat-type signal; /evidence=ECO:0000255|PROSITE-ProRule:PRU00648 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 14,883 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |