IED ID | IndEnz0017000018 |
Enzyme Type ID | manganese peroxidase000018 |
Protein Name |
Alkyl hydroperoxide reductase C EC 1.11.1.26 Peroxiredoxin Thioredoxin peroxidase |
Gene Name | ahpC SAOUHSC_00365 |
Organism | Staphylococcus aureus (strain NCTC 8325 / PS 47) |
Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus aureus Staphylococcus aureus (strain NCTC 8325 / PS 47) |
Enzyme Sequence | MSLINKEILPFTAQAFDPKKDQFKEVTQEDLKGSWSVVCFYPADFSFVCPTELEDLQNQYEELQKLGVNVFSVSTDTHFVHKAWHDHSDAISKITYTMIGDPSQTITRNFDVLDEATGLAQRGTFIIDPDGVVQASEINADGIGRDASTLAHKIKAAQYVRKNPGEVCPAKWEEGAKTLQPGLDLVGKI |
Enzyme Length | 189 |
Uniprot Accession Number | P0A0B7 |
Absorption | |
Active Site | ACT_SITE 49; /note=Cysteine sulfenic acid (-SOH) intermediate; /evidence=ECO:0000250|UniProtKB:P0A251 |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | CATALYTIC ACTIVITY: Reaction=a hydroperoxide + H(+) + NADH = an alcohol + H2O + NAD(+); Xref=Rhea:RHEA:62628, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:30879, ChEBI:CHEBI:35924, ChEBI:CHEBI:57540, ChEBI:CHEBI:57945; EC=1.11.1.26; Evidence={ECO:0000250|UniProtKB:P0A251}; |
DNA Binding | |
EC Number | 1.11.1.26 |
Enzyme Function | FUNCTION: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides. Is important for survival under desiccation conditions. Not required for virulence although is necessary for nasal colonization. {ECO:0000269|PubMed:17114262}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Active site (1); Chain (1); Disulfide bond (2); Domain (1); Initiator methionine (1); Sequence conflict (2) |
Keywords | Antioxidant;Cytoplasm;Direct protein sequencing;Disulfide bond;Oxidoreductase;Peroxidase;Redox-active center;Reference proteome |
Interact With | |
Induction | INDUCTION: Induced by iron and osmotic shock. Repressed under metal-depleted growth conditions and by manganese-rich growth conditions. Negatively regulated by the ferric uptake regulator (Fur) and PerR. {ECO:0000269|PubMed:14742543, ECO:0000269|PubMed:7551034}. |
Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250|UniProtKB:P0AE08}. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 20,977 |
Kinetics | |
Metal Binding | |
Rhea ID | RHEA:62628 |
Cross Reference Brenda |