| IED ID | IndEnz0017000038 |
| Enzyme Type ID | manganese peroxidase000038 |
| Protein Name |
Ferric uptake regulation protein Ferric uptake regulator |
| Gene Name | fur PA4764 |
| Organism | Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae Pseudomonas Pseudomonas aeruginosa group Pseudomonas aeruginosa Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) |
| Enzyme Sequence | MVENSELRKAGLKVTLPRVKILQMLDSAEQRHMSAEDVYKALMEAGEDVGLATVYRVLTQFEAAGLVVRHNFDGGHAVFELADSGHHDHMVCVDTGEVIEFMDAEIEKRQKEIVRERGFELVDHNLVLYVRKKK |
| Enzyme Length | 134 |
| Uniprot Accession Number | Q03456 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Fur acts as a repressor, employing Fe(2+) as a cofactor to bind the operator of the iron transport operon. Involved in exotoxin A regulation, siderophore regulation and manganese susceptibility. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (6); Chain (1); Helix (5); Metal binding (8); Region (2); Turn (3) |
| Keywords | 3D-structure;Cytoplasm;DNA-binding;Iron;Metal-binding;Reference proteome;Repressor;Transcription;Transcription regulation;Zinc |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (2) |
| Cross Reference PDB | 1MZB; 6H1C; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 15,234 |
| Kinetics | |
| Metal Binding | METAL 32; /note=Zinc; METAL 80; /note=Zinc; METAL 86; /note=Iron; /evidence=ECO:0000305; METAL 88; /note=Iron; /evidence=ECO:0000305; METAL 89; /note=Zinc; METAL 100; /note=Zinc; METAL 107; /note=Iron; /evidence=ECO:0000305; METAL 124; /note=Iron; /evidence=ECO:0000305 |
| Rhea ID | |
| Cross Reference Brenda |